![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462850264 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 126aa MW: 14254.2 Da PI: 10.3338 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 104.2 | 6.9e-33 | 48 | 106 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
462850264 48 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHS 106
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 3.5E-34 | 33 | 106 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 2.88E-29 | 40 | 107 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 29.356 | 43 | 108 | IPR003657 | WRKY domain |
| SMART | SM00774 | 9.8E-37 | 48 | 107 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 9.8E-26 | 49 | 105 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:1901141 | Biological Process | regulation of lignin biosynthetic process | ||||
| GO:1904369 | Biological Process | positive regulation of sclerenchyma cell differentiation | ||||
| GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 126 aa Download sequence Send to blast |
MTAGSGGAPA LGVGAVRMKK AGSGGGKARR KVREPRFCFK TMSDVDVLDD GYKWRKYGQK 60 VVKNTQHPRS YYRCTQDNCR VKKRVERLAE DPRMVITTYE GRHVHSPSRD EDDDAARANA 120 EMSFIW |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 2e-27 | 39 | 105 | 8 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 2e-27 | 39 | 105 | 8 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462850264 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT036900 | 1e-139 | BT036900.1 Zea mays full-length cDNA clone ZM_BFb0146L21 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025818604.1 | 4e-74 | probable WRKY transcription factor 13 | ||||
| Swissprot | Q9SVB7 | 7e-56 | WRK13_ARATH; Probable WRKY transcription factor 13 | ||||
| TrEMBL | A0A0A9RS81 | 4e-76 | A0A0A9RS81_ARUDO; Uncharacterized protein | ||||
| TrEMBL | A0A1E5WH29 | 1e-75 | A0A1E5WH29_9POAL; Putative WRKY transcription factor 13 | ||||
| STRING | GRMZM2G151444_P01 | 3e-71 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1138 | 38 | 130 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G39410.1 | 1e-49 | WRKY DNA-binding protein 13 | ||||




