![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462851070 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 102aa MW: 11208.3 Da PI: 8.4688 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 58.7 | 1.1e-18 | 33 | 75 | 2 | 44 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSS CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaed 44
+Dgy+W+KYGqK +k+ + +rsY+rC +++C +kkkve +d
462851070 33 EDGYEWKKYGQKFIKNIQKTRSYFRCRHKRCGAKKKVEWHPSD 75
7*************************************98877 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 1.0E-19 | 21 | 76 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 15.847 | 27 | 75 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 6.67E-18 | 28 | 76 | IPR003657 | WRKY domain |
| SMART | SM00774 | 6.0E-14 | 32 | 89 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.1E-16 | 33 | 75 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
MASTSHPAPK CEGEESTETA AETSNGSQIV MPEDGYEWKK YGQKFIKNIQ KTRSYFRCRH 60 KRCGAKKKVE WHPSDADGDG GGTANQYELG AQYFGGGGAR SQ |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462851070 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU970633 | 1e-52 | EU970633.1 Zea mays clone 348246 hypothetical protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004986337.2 | 9e-38 | probable WRKY transcription factor 71 | ||||
| TrEMBL | A0A368SIG9 | 2e-36 | A0A368SIG9_SETIT; Uncharacterized protein | ||||
| STRING | BRADI1G13207.1 | 1e-33 | (Brachypodium distachyon) | ||||
| STRING | Si038001m | 1e-33 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP10158 | 34 | 44 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G39410.1 | 4e-12 | WRKY DNA-binding protein 13 | ||||




