![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462852167 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 119aa MW: 12282.8 Da PI: 11.3796 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 65.3 | 1.1e-20 | 42 | 77 | 2 | 37 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCr 37
+e lkcprC+stntkfCy+nnyslsqPr+fCk+Cr
462852167 42 PEPGLKCPRCESTNTKFCYFNNYSLSQPRHFCKTCR 77
56789******************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 9.0E-25 | 26 | 77 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 17.579 | 46 | 99 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 3.0E-18 | 46 | 77 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 119 aa Download sequence Send to blast |
MAPRPDMATV GAATGSGGPI GGSAVRPGSM TERARLAKIP QPEPGLKCPR CESTNTKFCY 60 FNNYSLSQPR HFCKTCRPRA KGAPRRNKRS KSSKSSNSSS AASASAAGGT SSSTSSTPS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements. {ECO:0000269|PubMed:12887587}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462852167 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin and salicylic acid (SA). Repressed by jasmonic acid (JA). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:12887587}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC104433 | 2e-75 | AC104433.8 Oryza sativa chromosome 3 BAC OJ1754_E06 genomic sequence, complete sequence. | |||
| GenBank | AP014959 | 2e-75 | AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence. | |||
| GenBank | CP012611 | 2e-75 | CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004981250.1 | 5e-36 | dof zinc finger protein DOF2.4 | ||||
| Swissprot | Q9M2U1 | 1e-28 | DOF36_ARATH; Dof zinc finger protein DOF3.6 | ||||
| TrEMBL | A0A1D6L9X9 | 2e-36 | A0A1D6L9X9_MAIZE; Dof zinc finger protein DOF3.6 | ||||
| TrEMBL | A0A3L6SDN7 | 2e-36 | A0A3L6SDN7_PANMI; Dof zinc finger protein DOF2.4-like | ||||
| STRING | GRMZM2G093725_P01 | 3e-37 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP4893 | 29 | 61 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G02460.1 | 2e-28 | Dof family protein | ||||




