![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462868434 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 96aa MW: 11522.4 Da PI: 11.2995 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 50.8 | 3.6e-16 | 17 | 67 | 5 | 55 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
+r+rr++kNRe+A rsR+RK+a++ eLe +v++L+++Nk+L + eelk+
462868434 17 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNKELERKQEELKES 67
79**********************************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PRINTS | PR00041 | 2.3E-5 | 12 | 28 | IPR001630 | cAMP response element binding (CREB) protein |
| SMART | SM00338 | 2.2E-12 | 13 | 77 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 11.806 | 15 | 67 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14707 | 4.25E-17 | 17 | 69 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 3.0E-16 | 17 | 68 | No hit | No description |
| SuperFamily | SSF57959 | 2.7E-12 | 17 | 67 | No hit | No description |
| Pfam | PF00170 | 2.2E-14 | 17 | 68 | IPR004827 | Basic-leucine zipper domain |
| PROSITE pattern | PS00036 | 0 | 20 | 35 | IPR004827 | Basic-leucine zipper domain |
| PRINTS | PR00041 | 2.3E-5 | 30 | 50 | IPR001630 | cAMP response element binding (CREB) protein |
| PRINTS | PR00041 | 2.3E-5 | 50 | 67 | IPR001630 | cAMP response element binding (CREB) protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 96 aa Download sequence Send to blast |
MIRGRRNGAG VEKVVERRQR RMIKNRESAA RSRARKQAYT MELEAEVQKL KEQNKELERK 60 QEELKESQKN EVPEMLKDPF GRKKRLCLRR TLTGPW |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269|PubMed:10611387}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462868434 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By abscisic acid (ABA). {ECO:0000269|PubMed:10611387}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025802824.1 | 2e-54 | bZIP transcription factor TRAB1-like | ||||
| Swissprot | Q6ZDF3 | 4e-43 | TRAB1_ORYSJ; bZIP transcription factor TRAB1 | ||||
| TrEMBL | B4FU78 | 1e-53 | B4FU78_MAIZE; Uncharacterized protein | ||||
| STRING | Pavir.Ba02029.1.p | 8e-54 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP706 | 38 | 147 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G19290.1 | 5e-21 | ABRE binding factor 4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




