![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462868440 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 116aa MW: 12642.4 Da PI: 10.0309 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 79.5 | 5.4e-25 | 24 | 84 | 2 | 62 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62
Fl+k+++++e+++++e+isw e+g+sfvv+++ efa+++Lp +Fkhsnf+SFvRQLn+Y+
462868440 24 FLTKTHQMVEERATDEVISWAEQGRSFVVWKPVEFARDLLPLHFKHSNFSSFVRQLNTYNL 84
9**********************************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.0E-26 | 19 | 84 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 4.0E-21 | 20 | 110 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 7.35E-23 | 20 | 88 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 1.3E-14 | 24 | 47 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 1.9E-21 | 24 | 86 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.3E-14 | 62 | 74 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.3E-14 | 75 | 87 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 116 aa Download sequence Send to blast |
MATAAAGQPA KAGGRGGGGG PAPFLTKTHQ MVEERATDEV ISWAEQGRSF VVWKPVEFAR 60 DLLPLHFKHS NFSSFVRQLN TYNLAEPPLV TTSGRAHMFH CSFLLRVGSL FTNLNA |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1hks_A | 3e-16 | 17 | 94 | 1 | 77 | HEAT-SHOCK TRANSCRIPTION FACTOR |
| 1hkt_A | 3e-16 | 17 | 94 | 1 | 77 | HEAT-SHOCK TRANSCRIPTION FACTOR |
| Search in ModeBase | ||||||
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 12 | 19 | GGRGGGGG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462868440 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ727754 | 2e-85 | KJ727754.1 Zea mays clone pUT5697 HSF transcription factor (HSF21) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001150318.1 | 3e-40 | uncharacterized protein LOC100283948 | ||||
| Swissprot | Q67TP9 | 7e-35 | HSFB1_ORYSJ; Heat stress transcription factor B-1 | ||||
| TrEMBL | B6TNF2 | 8e-39 | B6TNF2_MAIZE; Heat shock factor protein 4 | ||||
| STRING | GRMZM2G139535_P02 | 4e-38 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP121 | 37 | 394 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G11660.1 | 5e-27 | HSF family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




