PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462868452
Organism
Eragrostis tef
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family bZIP
Protein Properties Length: 83aa    MW: 9925.45 Da    PI: 10.895
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462868452genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.81.5e-151767555
               CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
               +r+rr++kNRe+A rsR+RK+a++ eLe +v++L+++Nk+L  + eelk+ 
  462868452 17 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNKELERKQEELKES 67
               79**********************************************986 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.0E-161267No hitNo description
PRINTSPR000411.8E-51228IPR001630cAMP response element binding (CREB) protein
SMARTSM003383.4E-111374IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.8061567IPR004827Basic-leucine zipper domain
PfamPF001701.1E-131768IPR004827Basic-leucine zipper domain
CDDcd147073.30E-171769No hitNo description
SuperFamilySSF579594.0E-121767No hitNo description
PROSITE patternPS0003602035IPR004827Basic-leucine zipper domain
PRINTSPR000411.8E-53050IPR001630cAMP response element binding (CREB) protein
PRINTSPR000411.8E-55067IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MIRGRRNGAG VEKVVERRQR RMIKNRESAA RSRARKQAYT MELEAEVQKL KEQNKELERK  60
QEELKESQKN EVIAFIFLTY MPS
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269|PubMed:10611387}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462868452
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA). {ECO:0000269|PubMed:10611387}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0658739e-59AK065873.1 Oryza sativa Japonica Group cDNA clone:J013049N23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021320780.15e-35bZIP transcription factor TRAB1-like isoform X2
SwissprotQ6ZDF32e-31TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLK3ZU333e-35K3ZU33_SETIT; Uncharacterized protein
STRINGSi030114m6e-36(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.12e-20ABRE binding factor 4
Publications ? help Back to Top
  1. Kagaya Y,Hobo T,Murata M,Ban A,Hattori T
    Abscisic acid-induced transcription is mediated by phosphorylation of an abscisic acid response element binding factor, TRAB1.
    Plant Cell, 2002. 14(12): p. 3177-89
    [PMID:12468735]
  2. Kobayashi Y, et al.
    Abscisic acid-activated SNRK2 protein kinases function in the gene-regulation pathway of ABA signal transduction by phosphorylating ABA response element-binding factors.
    Plant J., 2005. 44(6): p. 939-49
    [PMID:16359387]
  3. Kobayashi F,Maeta E,Terashima A,Takumi S
    Positive role of a wheat HvABI5 ortholog in abiotic stress response of seedlings.
    Physiol Plant, 2008. 134(1): p. 74-86
    [PMID:18433415]