![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462876257 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 88aa MW: 9889.44 Da PI: 10.1748 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 62.1 | 1.2e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd+llvd v+ G+g+W++ ++ g++R++k+c++rw +yl
462876257 14 KGPWTPEEDKLLVDFVQANGSGNWRLLPKLAGLNRCGKSCRLRWTNYL 61
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 9.0E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 24.71 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.5E-14 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 3.4E-18 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.61E-23 | 15 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 7.26E-12 | 16 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 5.9E-8 | 65 | 88 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 7.534 | 66 | 88 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MGRTPCCDGK GVKKGPWTPE EDKLLVDFVQ ANGSGNWRLL PKLAGLNRCG KSCRLRWTNY 60 LRPDIKRGPF TTEEHNTILQ LHGIVGNK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 1e-16 | 14 | 88 | 7 | 80 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462876257 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK108621 | 5e-85 | AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002446850.1 | 6e-57 | transcription factor MYB41 | ||||
| Swissprot | Q9S9Z2 | 9e-46 | MYB93_ARATH; Transcription factor MYB93 | ||||
| TrEMBL | A0A2S3I8U3 | 6e-56 | A0A2S3I8U3_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A2T7CXW3 | 6e-56 | A0A2T7CXW3_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.Ga01101.1.p | 9e-56 | (Panicum virgatum) | ||||
| STRING | Sb06g023620.1 | 2e-56 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP5409 | 31 | 57 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G34670.1 | 4e-48 | myb domain protein 93 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




