![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462878314 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 113aa MW: 13103.9 Da PI: 9.2497 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 103.2 | 1.5e-32 | 43 | 90 | 4 | 51 |
zf-Dof 4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPv 51
+alkcprC+s+ntkf yynny+lsqPr+fCkaCrryWt+GG+lr vP+
462878314 43 EALKCPRCESSNTKFSYYNNYNLSQPRFFCKACRRYWTEGGTLRKVPI 90
689********************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 1.0E-20 | 39 | 90 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 2.2E-29 | 44 | 90 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 23.934 | 45 | 99 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 47 | 83 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 113 aa Download sequence Send to blast |
MDGKDAMGTA APVEEARKAR RQQQEQEVAG SGGECKPRPQ LVEALKCPRC ESSNTKFSYY 60 NNYNLSQPRF FCKACRRYWT EGGTLRKVPI RMPQEQAFIF LLYRDATFQL LHY |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. May enhance the DNA binding of the bZIP transcription factor Opaque-2 to O2 binding site elements. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462878314 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001105400.2 | 1e-32 | dof zinc finger protein PBF | ||||
| Swissprot | O24463 | 1e-33 | PBF_MAIZE; Dof zinc finger protein PBF | ||||
| TrEMBL | A0A096SFL6 | 3e-31 | A0A096SFL6_MAIZE; Prolamin box binding factor | ||||
| TrEMBL | B4FHP9 | 3e-31 | B4FHP9_MAIZE; Uncharacterized protein | ||||
| TrEMBL | K0D9S9 | 3e-31 | K0D9S9_MAIZE; DOF3 C2C2-DOF type transcription factor (Fragment) | ||||
| STRING | GRMZM2G146283_P01 | 6e-32 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP140 | 37 | 367 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G24060.1 | 9e-29 | Dof family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




