![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462879177 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 70aa MW: 8219.68 Da PI: 11.9809 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 92 | 2.9e-29 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krien++nrqvtfskRrng++KKA+ELSvLCd+++a+i+fs++++l +s
462879177 9 KRIENNTNRQVTFSKRRNGLIKKAYELSVLCDIDIALIMFSPSQRLSHFS 58
79********************************************9997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 29.086 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 8.7E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.01E-27 | 2 | 61 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.5E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 9.1E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.5E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.5E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
MGRVKLQIKR IENNTNRQVT FSKRRNGLIK KAYELSVLCD IDIALIMFSP SQRLSHFSGR 60 RRFVSLPLDR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 2e-19 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6byy_B | 2e-19 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6byy_C | 2e-19 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6byy_D | 2e-19 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6bz1_A | 2e-19 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6bz1_B | 2e-19 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6bz1_C | 2e-19 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| 6bz1_D | 2e-19 | 1 | 59 | 1 | 59 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462879177 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU975181 | 5e-66 | EU975181.1 Zea mays clone 483488 MADS-box protein AGL66 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021305672.1 | 1e-36 | agamous-like MADS-box protein AGL66 isoform X4 | ||||
| Refseq | XP_021305673.1 | 1e-36 | agamous-like MADS-box protein AGL66 isoform X4 | ||||
| Refseq | XP_021305674.1 | 1e-36 | agamous-like MADS-box protein AGL66 isoform X4 | ||||
| Refseq | XP_021305675.1 | 1e-36 | agamous-like MADS-box protein AGL66 isoform X4 | ||||
| Refseq | XP_021305676.1 | 1e-36 | agamous-like MADS-box protein AGL66 isoform X4 | ||||
| Refseq | XP_021305677.1 | 1e-36 | agamous-like MADS-box protein AGL66 isoform X4 | ||||
| Refseq | XP_021305678.1 | 1e-36 | agamous-like MADS-box protein AGL66 isoform X4 | ||||
| Refseq | XP_021305679.1 | 1e-36 | agamous-like MADS-box protein AGL66 isoform X5 | ||||
| Swissprot | Q9LM46 | 2e-31 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
| TrEMBL | A0A1D6LVJ2 | 7e-37 | A0A1D6LVJ2_MAIZE; Putative MADS-box transcription factor family protein | ||||
| STRING | Pavir.Db01574.1.p | 4e-36 | (Panicum virgatum) | ||||
| STRING | Sb10g007810.1 | 3e-36 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP4953 | 33 | 60 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G22130.1 | 7e-34 | AGAMOUS-like 104 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




