![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462889148 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 111aa MW: 12688.6 Da PI: 10.0508 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 34.7 | 4.1e-11 | 15 | 44 | 1 | 30 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIart 30
+g+WT+eEd++l+ +++q+G g+W++ +++
462889148 15 KGPWTPEEDQKLLAYIEQHGHGCWRSLPAK 44
79***********************98765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 17.842 | 10 | 88 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 6.96E-9 | 12 | 46 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 6.8E-23 | 13 | 78 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 6.4E-12 | 14 | 86 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.33E-9 | 17 | 84 | No hit | No description |
| Pfam | PF13921 | 2.2E-12 | 18 | 100 | No hit | No description |
| SuperFamily | SSF46689 | 9.67E-11 | 69 | 111 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 6.5E-11 | 79 | 111 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 8.012 | 89 | 111 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 111 aa Download sequence Send to blast |
MGRSPCCEKE AGLKKGPWTP EEDQKLLAYI EQHGHGCWRS LPAKAVQNVR PRMDGSDDGV 60 ACFRRAPGLR RCGKSCRLRW TNYLRPDIKR GKFTLQEEQT IIQLHALLGN R |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 9e-14 | 13 | 111 | 5 | 80 | B-MYB |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Functions as a repressor of epidermal cell outgrowth and negatively regulate trichome branch formation (PubMed:18805951, PubMed:21070410). Acts as both a positive and negative regulator of cellular outgrowth. Promotes both trichome expansion and branch formation (PubMed:21070410). Coordinately with WIN1/SHN1, participates in the regulation of cuticle biosynthesis and wax accumulation in reproductive organs and trichomes. Functions in cuticle nanoridge formation in petals and stamens, and in morphogenesis of petal conical cells and trichomes (PubMed:23709630). May play a role in the regulation of cuticle formation in vegetative organs (PubMed:24169067). {ECO:0000269|PubMed:18805951, ECO:0000269|PubMed:21070410, ECO:0000269|PubMed:23709630, ECO:0000269|PubMed:24169067}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462889148 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT054445 | 2e-60 | BT054445.1 Zea mays full-length cDNA clone ZM_BFc0062P12 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021315868.1 | 1e-54 | transcription factor MYB16 | ||||
| Refseq | XP_025817649.1 | 1e-54 | transcription factor MYB106-like | ||||
| Swissprot | Q9LE63 | 1e-49 | MY106_ARATH; Transcription factor MYB106 | ||||
| TrEMBL | A0A2S3GQC2 | 2e-53 | A0A2S3GQC2_9POAL; Uncharacterized protein | ||||
| TrEMBL | A3A8C2 | 2e-53 | A3A8C2_ORYSJ; Uncharacterized protein | ||||
| TrEMBL | Q6EP51 | 2e-53 | Q6EP51_ORYSJ; MYB27 protein-like | ||||
| STRING | Pavir.Ab02021.1.p | 4e-54 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP79 | 38 | 563 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G15310.1 | 5e-51 | myb domain protein 16 | ||||




