![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462890926 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 103aa MW: 12075.8 Da PI: 10.5843 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 107.9 | 4.9e-34 | 23 | 81 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+s fprsYYrCt+++C+vkk+v+r a+d+++v++tYeg Hnh+
462890926 23 LDDGYRWRKYGQKAVKNSAFPRSYYRCTHHTCNVKKQVQRLAKDTSIVVTTYEGVHNHP 81
59********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 1.2E-34 | 9 | 81 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.12E-29 | 15 | 82 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 28.713 | 18 | 83 | IPR003657 | WRKY domain |
| SMART | SM00774 | 7.7E-39 | 23 | 82 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 4.5E-27 | 24 | 81 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
GRGKKKASRP RFAFQTKSEN DILDDGYRWR KYGQKAVKNS AFPRSYYRCT HHTCNVKKQV 60 QRLAKDTSIV VTTYEGVHNH PCEKLMEALT PILRQLQFLS QFQ |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 1e-27 | 13 | 80 | 7 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 1e-27 | 13 | 80 | 7 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462890926 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | DQ840412 | 1e-104 | DQ840412.1 Hordeum vulgare subsp. vulgare WRKY transcription factor 13 (WRKY13) mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020160818.1 | 8e-69 | probable WRKY transcription factor 75 | ||||
| Swissprot | Q8VWQ4 | 1e-56 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
| TrEMBL | A0A3B5Y5P3 | 6e-69 | A0A3B5Y5P3_WHEAT; Uncharacterized protein | ||||
| STRING | Traes_1AL_0404BC790.1 | 9e-70 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1100 | 38 | 133 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G64000.1 | 4e-59 | WRKY DNA-binding protein 56 | ||||




