PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462891542

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

MYB_related

Protein Properties

Length: 75aa MW: 8465.73 Da PI: 10.6623

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462891542	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	50.2	6.1e-16	14	56	1	43
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 +g+WT+eEde+lv ++k +G g+W++ +r g+ R++k+c++r 462891542 14 KGAWTKEEDERLVAYIKAHGEGCWRSLPRAAGLLRCGKSCRLR 56 79****************************99*****98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	4.6E-17	5	56	IPR009057	Homeodomain-like
SuperFamily	SSF46689	4.31E-11	9	57	IPR009057	Homeodomain-like
PROSITE profile	PS51294	15.412	9	65	IPR017930	Myb domain
SMART	SM00717	3.7E-6	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-12	14	56	IPR001005	SANT/Myb domain
CDD	cd00167	1.18E-8	16	56	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 75 aa Download sequence Send to blast
MGRSPCCEKA HTNKGAWTKE EDERLVAYIK AHGEGCWRSL PRAAGLLRCG KSCRLRRRGR 60 AHHPTPQPAR QQCQA

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462891542

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AM156906	2e-62	AM156906.1 Zea mays mRNA for transcription factor MYB31 (myb31 gene).
GenBank	BT038812	2e-62	BT038812.1 Zea mays full-length cDNA clone ZM_BFb0329H19 mRNA, complete cds.
GenBank	HQ858793	2e-62	HQ858793.1 Zea mays clone UT1854 MYB transcription factor mRNA, partial cds.
GenBank	JF957080	2e-62	JF957080.1 Agropyron cristatum transcription factor myb-like protein mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016714474.1	2e-33	PREDICTED: myb-related protein 308-like
Refseq	XP_017632883.1	2e-33	PREDICTED: myb-related protein 308-like
Refseq	XP_020111295.1	3e-33	myb-related protein 308-like
Swissprot	Q9SZP1	7e-34	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A0A0A0K4N0	5e-33	A0A0A0K4N0_CUCSA; MYB domain class transcription factor
STRING	EMT26190	1e-32	(Aegilops tauschii)
STRING	Si011098m	2e-32	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP116	37	448

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	3e-36	myb domain protein 4

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]