![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462893456 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 90aa MW: 10343 Da PI: 8.6164 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 54 | 3e-17 | 14 | 79 | 31 | 98 |
.--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
B3 31 eesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
+ + ++tl d++g+sWev + y+k+sg+ ++ +GW Fv n+++ D+++F++ ++++++v+vfr
462893456 14 KANAKVTLWDPQGKSWEVCYMYSKSSGGAYFCRGWGAFVVGNNIEKDDICIFYFF--KKKNMKVGVFR 79
34569************************************************75..577789**998 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM01019 | 4.9E-4 | 1 | 81 | IPR003340 | B3 DNA binding domain |
| PROSITE profile | PS50863 | 13.239 | 1 | 81 | IPR003340 | B3 DNA binding domain |
| CDD | cd10017 | 7.15E-18 | 1 | 79 | No hit | No description |
| Gene3D | G3DSA:2.40.330.10 | 4.1E-19 | 2 | 79 | IPR015300 | DNA-binding pseudobarrel domain |
| SuperFamily | SSF101936 | 1.49E-20 | 2 | 79 | IPR015300 | DNA-binding pseudobarrel domain |
| Pfam | PF02362 | 4.9E-15 | 4 | 79 | IPR003340 | B3 DNA binding domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
MEFPSDIVMK YLPKANAKVT LWDPQGKSWE VCYMYSKSSG GAYFCRGWGA FVVGNNIEKD 60 DICIFYFFKK KNMKVGVFRV LQETTPSSEC |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462893456 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021316377.1 | 8e-24 | B3 domain-containing protein Os11g0197600 isoform X1 | ||||
| Refseq | XP_021316378.1 | 8e-24 | B3 domain-containing protein Os11g0197600 isoform X1 | ||||
| TrEMBL | A0A0A9NR78 | 4e-23 | A0A0A9NR78_ARUDO; Uncharacterized protein | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP4461 | 37 | 66 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G18990.1 | 1e-07 | B3 family protein | ||||




