![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462894131 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 76aa MW: 8525.59 Da PI: 5.1105 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 58.4 | 1.8e-18 | 2 | 41 | 56 | 95 |
NF-YB 56 rekrktingddllwalatlGfedyveplkvylkkyreleg 95
+ekrktingddl+w+l+tlGfedyveplk+ylk yre ++
462894131 2 KEKRKTINGDDLIWSLGTLGFEDYVEPLKLYLKLYREGDT 41
8***********************************9665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 5.8E-15 | 2 | 54 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.38E-12 | 2 | 55 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
MKEKRKTING DDLIWSLGTL GFEDYVEPLK LYLKLYREGD TKGSKTSDQT GKKEILLNGE 60 PGSSLRYGID QGTAEQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462894131 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KM078742 | 2e-44 | KM078742.1 Triticum aestivum CCAAT-binding transcription factor A (NFYB-D11) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025805143.1 | 5e-34 | nuclear transcription factor Y subunit B-4-like | ||||
| Refseq | XP_025805144.1 | 5e-34 | nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | Q65XK1 | 3e-30 | NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A0A9KDX5 | 3e-33 | A0A0A9KDX5_ARUDO; Uncharacterized protein | ||||
| TrEMBL | A0A0A9PIF8 | 9e-33 | A0A0A9PIF8_ARUDO; Uncharacterized protein | ||||
| TrEMBL | A0A2T7EA31 | 3e-32 | A0A2T7EA31_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A2T8KII4 | 3e-32 | A0A2T8KII4_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A2T8KIK1 | 4e-32 | A0A2T8KIK1_9POAL; Uncharacterized protein | ||||
| TrEMBL | K3ZDG1 | 1e-32 | K3ZDG1_SETIT; Uncharacterized protein | ||||
| STRING | Sb09g029140.1 | 5e-34 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP25630 | 5 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.7 | 2e-21 | nuclear factor Y, subunit B1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




