![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462894134 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 64aa MW: 6951.77 Da PI: 4.4984 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 83.6 | 2.3e-26 | 17 | 64 | 2 | 49 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtse 49
+eqdrflPian+srim++++P+n+ki+kdak++vqecvsefisf+tse
462894134 17 KEQDRFLPIANISRIMRRAVPENGKIAKDAKDSVQECVSEFISFITSE 64
89********************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.8E-23 | 14 | 64 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 5.24E-16 | 19 | 64 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 7.3E-17 | 22 | 64 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 64 aa Download sequence Send to blast |
MSEGEYTLEG GSGAGGKEQD RFLPIANISR IMRRAVPENG KIAKDAKDSV QECVSEFISF 60 ITSE |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-22 | 17 | 64 | 2 | 49 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-22 | 17 | 64 | 2 | 49 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May regulate the expression of photosynthetic genes, and may be involved in chloroplast and amyloplast development. {ECO:0000269|PubMed:14617083}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462894134 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC104284 | 2e-65 | AC104284.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OJ1735_C10, complete sequence. | |||
| GenBank | AP014961 | 2e-65 | AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence. | |||
| GenBank | CP012613 | 2e-65 | CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025805143.1 | 8e-29 | nuclear transcription factor Y subunit B-4-like | ||||
| Refseq | XP_025805144.1 | 8e-29 | nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | Q65XK1 | 7e-26 | NFYB4_ORYSJ; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A0A9PIF8 | 2e-28 | A0A0A9PIF8_ARUDO; Uncharacterized protein | ||||
| STRING | Pavir.J18451.1.p | 1e-28 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP18750 | 5 | 9 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.6 | 9e-28 | nuclear factor Y, subunit B1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




