PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462896096

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

M-type_MADS

Protein Properties

Length: 66aa MW: 7462.72 Da PI: 10.8519

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462896096	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	98.7	2.4e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklyey+s 462896096 9 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSTRGKLYEYAS 59 79***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	31.735	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.7E-39	1	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.6E-32	3	23	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	8.11E-30	3	61	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.58E-38	3	62	No hit	No description
Pfam	PF00319	1.4E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.6E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.6E-32	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 66 aa Download sequence Send to blast
MVRGKTQMKR IENPTSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFST RGKLYEYASA 60 SFAFAT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3mu6_A	1e-19	3	61	2	60	Myocyte-specific enhancer factor 2A
3mu6_B	1e-19	3	61	2	60	Myocyte-specific enhancer factor 2A
3mu6_C	1e-19	3	61	2	60	Myocyte-specific enhancer factor 2A
3mu6_D	1e-19	3	61	2	60	Myocyte-specific enhancer factor 2A
5f28_A	1e-19	1	62	1	62	MEF2C
5f28_B	1e-19	1	62	1	62	MEF2C
5f28_C	1e-19	1	62	1	62	MEF2C
5f28_D	1e-19	1	62	1	62	MEF2C
6byy_A	1e-19	1	62	1	62	MEF2 CHIMERA
6byy_B	1e-19	1	62	1	62	MEF2 CHIMERA
6byy_C	1e-19	1	62	1	62	MEF2 CHIMERA
6byy_D	1e-19	1	62	1	62	MEF2 CHIMERA
6bz1_A	2e-19	1	62	1	62	MEF2 CHIMERA
6bz1_B	2e-19	1	62	1	62	MEF2 CHIMERA
6bz1_C	2e-19	1	62	1	62	MEF2 CHIMERA
6bz1_D	2e-19	1	62	1	62	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269\|PubMed:15144377, ECO:0000269\|PubMed:17166135}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462896096

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB003328	1e-66	AB003328.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:S11905.
GenBank	AK067641	1e-66	AK067641.1 Oryza sativa Japonica Group cDNA clone:J013108C22, full insert sequence.
GenBank	AK104921	1e-66	AK104921.1 Oryza sativa Japonica Group cDNA clone:001-047-H02, full insert sequence.
GenBank	AY332476	1e-66	AY332476.1 Oryza sativa (japonica cultivar-group) MADS box protein (AGL20) mRNA, complete cds.
GenBank	CT830037	1e-66	CT830037.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA030D10, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006649298.1	4e-35	PREDICTED: MADS-box transcription factor 50-like
Refseq	XP_015630979.1	4e-35	MADS-box transcription factor 50
Refseq	XP_015691000.1	4e-35	PREDICTED: MADS-box transcription factor 50-like
Refseq	XP_015691001.1	4e-35	PREDICTED: MADS-box transcription factor 50-like
Refseq	XP_025880188.1	4e-35	MADS-box transcription factor 50
Swissprot	Q9XJ60	4e-36	MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBL	A0A0D9Z1D6	3e-34	A0A0D9Z1D6_9ORYZ; Uncharacterized protein
TrEMBL	B9FAU1	2e-34	B9FAU1_ORYSJ; Uncharacterized protein
TrEMBL	Q6Q9I7	2e-34	Q6Q9I7_ORYSJ; MADS-box protein RMADS210
STRING	OGLUM03G01750.2	1e-34	(Oryza glumipatula)
STRING	OB03G11760.1	1e-34	(Oryza brachyantha)
STRING	ORGLA03G0015400.1	1e-34	(Oryza glaberrima)
STRING	OBART03G01800.1	1e-34	(Oryza barthii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G11880.1	3e-35	AGAMOUS-like 14

Publications ? help Back to Top
Thomson MJ,Edwards JD,Septiningsih EM,Harrington SE,McCouch SR Substitution mapping of dth1.1, a flowering-time quantitative trait locus (QTL) associated with transgressive variation in rice, reveals multiple sub-QTL. Genetics, 2006. 172(4): p. 2501-14 [PMID:16452146] Park SJ, et al. Rice Indeterminate 1 (OsId1) is necessary for the expression of Ehd1 (Early heading date 1) regardless of photoperiod. Plant J., 2008. 56(6): p. 1018-29 [PMID:18774969] Lee S,Jeong DH,An G A possible working mechanism for rice SVP-group MADS-box proteins as negative regulators of brassinosteroid responses. Plant Signal Behav, 2008. 3(7): p. 471-4 [PMID:19704489] Maas LF,McClung A,McCouch S Dissection of a QTL reveals an adaptive, interacting gene complex associated with transgressive variation for flowering time in rice. Theor. Appl. Genet., 2010. 120(5): p. 895-908 [PMID:19949767] Sun C, et al. The histone methyltransferase SDG724 mediates H3K36me2/3 deposition at MADS50 and RFT1 and promotes flowering in rice. Plant Cell, 2012. 24(8): p. 3235-47 [PMID:22892321] Choi SC, et al. Trithorax group protein Oryza sativa Trithorax1 controls flowering time in rice via interaction with early heading date3. Plant Physiol., 2014. 164(3): p. 1326-37 [PMID:24420930] Núñez-López L,Aguirre-Cruz A,Barrera-Figueroa BE,Peña-Castro JM Improvement of enzymatic saccharification yield in Arabidopsis thaliana by ectopic expression of the rice SUB1A-1 transcription factor. PeerJ, 2015. 3: p. e817 [PMID:25780769] Jin J, et al. MORF-RELATED GENE702, a Reader Protein of Trimethylated Histone H3 Lysine 4 and Histone H3 Lysine 36, Is Involved in Brassinosteroid-Regulated Growth and Flowering Time Control in Rice. Plant Physiol., 2015. 168(4): p. 1275-85 [PMID:25855537] Liu X, et al. Brassinosteroid (BR) biosynthetic gene lhdd10 controls late heading and plant height in rice (Oryza sativa L.). Plant Cell Rep., 2016. 35(2): p. 357-68 [PMID:26518431] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Shibaya T, et al. Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice. Plant Cell Physiol., 2016. 57(9): p. 1828-38 [PMID:27318280] Alter P, et al. Flowering Time-Regulated Genes in Maize Include the Transcription Factor ZmMADS1. Plant Physiol., 2016. 172(1): p. 389-404 [PMID:27457125]