PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462896630

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

NAC

Protein Properties

Length: 177aa MW: 20219.9 Da PI: 9.4017

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462896630	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	176.9	5.6e-55	22	150	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kgel 99 lppGfrFhPtdeelv++yL +k+ + ++ ++i+e+d++k+ePw+Lp k+k +ekewyfFs rd+ky+tg r+nrat +gyWkatgkd+e+ s+ +g+l 462896630 22 LPPGFRFHPTDEELVSYYLFRKAVDGTFCG-RAIAEIDLNKCEPWELPDKAKMGEKEWYFFSLRDRKYPTGLRTNRATVAGYWKATGKDREIRSArTGAL 120 79***********************888.88***********99999************************************9868889 PP NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129 vg+kktLvfy+grapkg+kt+Wvmheyrle 462896630 121 VGMKKTLVFYRGRAPKGNKTSWVMHEYRLE 150 **************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.22E-58	21	158	IPR003441	NAC domain
PROSITE profile	PS51005	55.66	22	173	IPR003441	NAC domain
Pfam	PF02365	1.3E-28	23	149	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 177 aa Download sequence Send to blast
MERFGLGGAL GLDLGGVGGG DLPPGFRFHP TDEELVSYYL FRKAVDGTFC GRAIAEIDLN 60 KCEPWELPDK AKMGEKEWYF FSLRDRKYPT GLRTNRATVA GYWKATGKDR EIRSARTGAL 120 VGMKKTLVFY RGRAPKGNKT SWVMHEYRLE GTYAYHYHPG STRQHYTYRV ETQCNDD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-52	22	149	17	142	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-52	22	149	17	142	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-52	22	149	17	142	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-52	22	149	17	142	NO APICAL MERISTEM PROTEIN
3swm_A	4e-52	22	149	20	145	NAC domain-containing protein 19
3swm_B	4e-52	22	149	20	145	NAC domain-containing protein 19
3swm_C	4e-52	22	149	20	145	NAC domain-containing protein 19
3swm_D	4e-52	22	149	20	145	NAC domain-containing protein 19
3swp_A	4e-52	22	149	20	145	NAC domain-containing protein 19
3swp_B	4e-52	22	149	20	145	NAC domain-containing protein 19
3swp_C	4e-52	22	149	20	145	NAC domain-containing protein 19
3swp_D	4e-52	22	149	20	145	NAC domain-containing protein 19
4dul_A	4e-52	22	149	17	142	NAC domain-containing protein 19
4dul_B	4e-52	22	149	17	142	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Controls leaf margin development and required for leaf serration. Involved in axillary meristem initiation and separation of the meristem from the main stem. Regulates the phyllotaxy throughout the plant development. Seems to act as an inhibitor of cell division. {ECO:0000269\|PubMed:10079219, ECO:0000269\|PubMed:10750709, ECO:0000269\|PubMed:12163400, ECO:0000269\|PubMed:12492830, ECO:0000269\|PubMed:12610213, ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15500463, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16798887, ECO:0000269\|PubMed:17098808, ECO:0000269\|PubMed:17122068, ECO:0000269\|PubMed:17251269, ECO:0000269\|PubMed:17287247, ECO:0000269\|PubMed:9212461}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462896630

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM and SYD, at the chromatin level, and conferring a very specific spatial expression pattern. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16854978, ECO:0000269\|PubMed:17251269, ECO:0000269\|PubMed:17287247}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU970442	1e-161	EU970442.1 Zea mays clone 345601 CUC2 mRNA, complete cds.
GenBank	KJ727847	1e-161	KJ727847.1 Zea mays clone pUT5891 NAC transcription factor (NAC119) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025812735.1	9e-99	protein CUP-SHAPED COTYLEDON 1-like
Swissprot	O04017	8e-81	NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBL	A0A2T7DZC6	2e-97	A0A2T7DZC6_9POAL; Uncharacterized protein
STRING	Pavir.J00978.1.p	7e-91	(Panicum virgatum)
STRING	GRMZM2G139700_P01	3e-90	(Zea mays)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP9940	35	43

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G53950.1	5e-79	NAC family protein

Publications ? help Back to Top
Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development. Front Plant Sci, 2014. 5: p. 165 [PMID:24817871] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Vialette-Guiraud AC, et al. A Conserved Role for the NAM/miR164 Developmental Module Reveals a Common Mechanism Underlying Carpel Margin Fusion in Monocarpous and Syncarpous Eurosids. Front Plant Sci, 2015. 6: p. 1239 [PMID:26793217] Cui X, et al. REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis. Nat. Genet., 2016. 48(6): p. 694-9 [PMID:27111035] Blein T,Pautot V,Laufs P Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection. Plants (Basel), 2013. 2(2): p. 230-47 [PMID:27137374] Biot E, et al. Multiscale quantification of morphodynamics: MorphoLeaf software for 2D shape analysis. Development, 2016. 143(18): p. 3417-28 [PMID:27387872] Zheng M, et al. Chloroplast Translation Initiation Factors Regulate Leaf Variegation and Development. Plant Physiol., 2016. 172(2): p. 1117-1130 [PMID:27535792] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] González-Carranza ZH, et al. HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression. PLoS ONE, 2017. 12(9): p. e0185106 [PMID:28934292] Wilson-Sánchez D,Martínez-López S,Navarro-Cartagena S,Jover-Gil S,Micol JL Members of the DEAL subfamily of the DUF1218 gene family are required for bilateral symmetry but not for dorsoventrality in Arabidopsis leaves. New Phytol., 2018. 217(3): p. 1307-1321 [PMID:29139551] Gonçalves B, et al. GDP-L-fucose is required for boundary definition in plants. J. Exp. Bot., 2017. 68(21-22): p. 5801-5811 [PMID:29186469] Sha S, et al. To be serrate or pinnate: diverse leaf forms of yarrows (Achillea) are linked to differential expression patterns of NAM genes. Ann. Bot., 2018. 121(2): p. 255-266 [PMID:29267935] Maugarny-Calès A, et al. Dissecting the pathways coordinating patterning and growth by plant boundary domains. PLoS Genet., 2019. 15(1): p. e1007913 [PMID:30677017]