PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462902156

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

MYB_related

Protein Properties

Length: 87aa MW: 10181.8 Da PI: 10.0477

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462902156	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	60.7	3.1e-19	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg W++eEde+lv++++ +G +W++++++ g+ R++k+c++rw +yl 462902156 13 RGLWSPEEDEKLVRYITAHGHSCWSSVPKHAGLQRCGKSCRLRWINYL 60 789*******************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.6E-28	4	63	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.237	8	64	IPR017930	Myb domain
SMART	SM00717	2.1E-13	12	62	IPR001005	SANT/Myb domain
Pfam	PF00249	7.3E-17	13	60	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.19E-21	15	87	IPR009057	Homeodomain-like
CDD	cd00167	4.89E-11	16	60	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.5E-7	64	87	IPR009057	Homeodomain-like
PROSITE profile	PS51294	7.327	65	87	IPR017930	Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 87 aa Download sequence Send to blast
MGHHCCSKQK VKRGLWSPEE DEKLVRYITA HGHSCWSSVP KHAGLQRCGK SCRLRWINYL 60 RPDLKRGTFS DQEERIIIDV HRILGNK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-16	13	87	7	80	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269\|PubMed:12753590, ECO:0000269\|PubMed:17147638, ECO:0000269\|PubMed:17329564}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462902156

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by auxin. {ECO:0000269\|PubMed:23410518}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP004006	1e-54	AP004006.5 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1197_D06.
GenBank	AP004259	1e-54	AP004259.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0005E02.
GenBank	AP014963	1e-54	AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBank	CP012615	1e-54	CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004957753.1	5e-61	transcription factor MYB61
Swissprot	Q9SPG3	8e-47	MYB26_ARATH; Transcription factor MYB26
TrEMBL	K3ZU71	1e-59	K3ZU71_SETIT; Uncharacterized protein
STRING	Si030152m	2e-60	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP9751	35	45

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G12720.1	1e-54	myb domain protein 67

Publications ? help Back to Top
Coego A, et al. The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression. Plant J., 2014. 77(6): p. 944-53 [PMID:24456507] Yang C, et al. Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation. Plant Physiol., 2017. 175(1): p. 333-350 [PMID:28724622] Ghelli R, et al. A Newly Identified Flower-Specific Splice Variant of AUXIN RESPONSE FACTOR8 Regulates Stamen Elongation and Endothecium Lignification in Arabidopsis. Plant Cell, 2018. 30(3): p. 620-637 [PMID:29514943]