![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462902354 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 162aa MW: 18813.5 Da PI: 7.3439 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 46.6 | 7.8e-15 | 8 | 53 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
g W Ede+l+ av ++G+++W++I++ + ++++kqck rw+ +l
462902354 8 GVWKNTEDEILKAAVMKYGKNQWARISSLVV-RKSAKQCKARWYEWL 53
78*****************************.************986 PP
| |||||||
| 2 | Myb_DNA-binding | 31.4 | 4.3e-10 | 60 | 99 | 2 | 44 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
WT eEde+l+++ k++++ W+tIa +g Rt+ qc +r
462902354 60 TEWTREEDEKLLHLAKLMPTQ-WRTIAPIVG--RTPSQCLERH 99
68*****************99.********8..******8885 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 21.975 | 2 | 57 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 7.1E-19 | 5 | 56 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 8.7E-15 | 6 | 55 | IPR001005 | SANT/Myb domain |
| Pfam | PF13921 | 8.1E-14 | 10 | 70 | No hit | No description |
| CDD | cd00167 | 1.07E-11 | 10 | 53 | No hit | No description |
| SuperFamily | SSF46689 | 3.25E-21 | 33 | 108 | IPR009057 | Homeodomain-like |
| CDD | cd11659 | 1.27E-30 | 55 | 106 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.2E-14 | 57 | 104 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 4.4E-10 | 58 | 105 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 15.533 | 58 | 107 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 162 aa Download sequence Send to blast |
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLVVRK SAKQCKARWY EWLDPSIKKT 60 EWTREEDEKL LHLAKLMPTQ WRTIAPIVGR TPSQCLERHE KLLDAACAKD ENYEPNDDPR 120 KLRPGEIDPN PESKPACPDP VDMDEDEKEM LSEARARCQH QG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5mqf_L | 1e-88 | 2 | 158 | 3 | 159 | Cell division cycle 5-like protein |
| 5xjc_L | 1e-88 | 2 | 158 | 3 | 159 | Cell division cycle 5-like protein |
| 5yzg_L | 1e-88 | 2 | 158 | 3 | 159 | Cell division cycle 5-like protein |
| 5z56_L | 1e-88 | 2 | 158 | 3 | 159 | Cell division cycle 5-like protein |
| 5z57_L | 1e-88 | 2 | 158 | 3 | 159 | Cell division cycle 5-like protein |
| 5z58_L | 1e-88 | 2 | 158 | 3 | 159 | Cell division cycle 5-like protein |
| 6ff4_L | 1e-88 | 2 | 158 | 3 | 159 | Cell division cycle 5-like protein |
| 6ff7_L | 1e-88 | 2 | 158 | 3 | 159 | Cell division cycle 5-like protein |
| 6icz_L | 1e-88 | 2 | 158 | 3 | 159 | Cell division cycle 5-like protein |
| 6id0_L | 1e-88 | 2 | 158 | 3 | 159 | Cell division cycle 5-like protein |
| 6id1_L | 1e-88 | 2 | 158 | 3 | 159 | Cell division cycle 5-like protein |
| 6qdv_O | 1e-88 | 2 | 158 | 3 | 159 | Cell division cycle 5-like protein |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462902354 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK102248 | 0.0 | AK102248.1 Oryza sativa Japonica Group cDNA clone:J033088F07, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003576174.1 | 1e-106 | cell division cycle 5-like protein | ||||
| Refseq | XP_019232628.1 | 1e-107 | PREDICTED: cell division cycle 5-like protein | ||||
| Swissprot | P92948 | 1e-102 | CDC5L_ARATH; Cell division cycle 5-like protein | ||||
| TrEMBL | A0A067DSG9 | 1e-107 | A0A067DSG9_CITSI; Uncharacterized protein | ||||
| STRING | Pavir.Ca02612.1.p | 1e-107 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP25524 | 3 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09770.1 | 1e-105 | cell division cycle 5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




