PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462902357

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

MYB_related

Protein Properties

Length: 69aa MW: 7969.47 Da PI: 10.7674

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462902357	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	49.5	9.6e-16	8	53	2	48
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 g W Ede+l+ av ++G+++W++I++ + ++++kqck rw+ +l 462902357 8 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 53 78***************************.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	22.008	2	57	IPR017930	Myb domain
SuperFamily	SSF46689	8.61E-16	3	59	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	7.6E-19	5	59	IPR009057	Homeodomain-like
SMART	SM00717	7.0E-15	6	55	IPR001005	SANT/Myb domain
Pfam	PF00249	1.1E-13	8	53	IPR001005	SANT/Myb domain
CDD	cd00167	7.20E-12	10	53	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 69 aa Download sequence Send to blast
MRIMIKGGVW KNTEDEILKA AVMKYGKNQW ARISSLLVRK SAKQCKARWY EWLDPSIKKV 60 SGLKALTTD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5mqf_L	8e-33	2	61	3	62	Cell division cycle 5-like protein
5xjc_L	8e-33	2	61	3	62	Cell division cycle 5-like protein
5yzg_L	8e-33	2	61	3	62	Cell division cycle 5-like protein
5z56_L	8e-33	2	61	3	62	Cell division cycle 5-like protein
5z57_L	8e-33	2	61	3	62	Cell division cycle 5-like protein
5z58_L	8e-33	2	61	3	62	Cell division cycle 5-like protein
6ff4_L	8e-33	2	61	3	62	Cell division cycle 5-like protein
6ff7_L	8e-33	2	61	3	62	Cell division cycle 5-like protein
6icz_L	8e-33	2	61	3	62	Cell division cycle 5-like protein
6id0_L	8e-33	2	61	3	62	Cell division cycle 5-like protein
6id1_L	8e-33	2	61	3	62	Cell division cycle 5-like protein
6qdv_O	8e-33	2	61	3	62	Cell division cycle 5-like protein
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250\|UniProtKB:Q99459, ECO:0000269\|PubMed:17298883, ECO:0000269\|PubMed:17575050, ECO:0000269\|PubMed:8917598}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462902357

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT083884	1e-69	BT083884.1 Zea mays full-length cDNA clone ZM_BFb0050M19 mRNA, complete cds.
GenBank	BT084671	1e-69	BT084671.2 Zea mays full-length cDNA clone ZM_BFb0156B24 mRNA, complete cds.
GenBank	CP012612	1e-69	CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
GenBank	CR855091	1e-69	CR855091.1 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSIGBa0130K07, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002507152.1	1e-35	predicted protein, partial
Refseq	XP_003056512.1	2e-35	predicted protein, partial
Refseq	XP_016455096.1	6e-35	PREDICTED: cell division cycle 5-like protein
Refseq	XP_016516169.1	5e-36	PREDICTED: cell division cycle 5-like protein, partial
Refseq	XP_019232628.1	2e-35	PREDICTED: cell division cycle 5-like protein
Swissprot	P92948	1e-35	CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBL	A0A438E904	3e-36	A0A438E904_VITVI; Cell division cycle 5-like protein
STRING	VIT_14s0036g00500.t01	1e-35	(Vitis vinifera)
STRING	evm.model.supercontig_306.1	2e-34	(Carica papaya)
STRING	XP_003056512.1	7e-35	(Micromonas pusilla)
STRING	Lus10043451	4e-35	(Linum usitatissimum)
STRING	XP_009798344.1	3e-34	(Nicotiana sylvestris)
STRING	PGSC0003DMT400029953	3e-34	(Solanum tuberosum)
STRING	ORUFI04G09590.1	3e-34	(Oryza rufipogon)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP25524	3	5

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09770.1	5e-38	cell division cycle 5

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Li S, et al. MAC3A and MAC3B, Two Core Subunits of the MOS4-Associated Complex, Positively Influence miRNA Biogenesis. Plant Cell, 2018. 30(2): p. 481-494 [PMID:29437988]