PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462903067
Organism
Eragrostis tef
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family WRKY
Protein Properties Length: 78aa    MW: 9059.99 Da    PI: 5.5394
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462903067genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY568.1e-1816601559
               -TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY 15 vkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
               +++++   sY+rCt+++C+vkk+ver ++d ++v++tYeg+H+h+
  462903067 16 IEDTRPDSSYFRCTHSNCRVKKRVERLSTDCRMVITTYEGRHTHS 60
               556666679***********************************7 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031062.2E-131359IPR003657WRKY domain
SuperFamilySSF1182902.62E-141560IPR003657WRKY domain
SMARTSM007749.2E-91561IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.9E-151660IPR003657WRKY domain
PROSITE profilePS5081114.6762459IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MIARLLFSFE MDENEIEDTR PDSSYFRCTH SNCRVKKRVE RLSTDCRMVI TTYEGRHTHS  60
PCSDDASSGD HTDCFSSF
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462903067
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU0586109e-68KU058610.1 UNVERIFIED: Panicum miliaceum WRKY22-like gene, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001335044.12e-32probable WRKY transcription factor 12
RefseqXP_025793222.11e-32probable WRKY transcription factor 12
SwissprotQ93WY41e-22WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A0A9FHL03e-31A0A0A9FHL0_ARUDO; Uncharacterized protein
STRINGPavir.J08471.1.p5e-32(Panicum virgatum)
STRINGGRMZM2G377217_P016e-32(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.14e-25WRKY family protein
Publications ? help Back to Top
  1. Yu Y, et al.
    MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering.
    Plant Sci., 2013. 212: p. 1-9
    [PMID:24094048]
  2. Yang L, et al.
    PtrWRKY19, a novel WRKY transcription factor, contributes to the regulation of pith secondary wall formation in Populus trichocarpa.
    Sci Rep, 2016. 6: p. 18643
    [PMID:26819184]
  3. Li W,Wang H,Yu D
    Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions.
    Mol Plant, 2016. 9(11): p. 1492-1503
    [PMID:27592586]
  4. Han Y, et al.
    WRKY12 represses GSH1 expression to negatively regulate cadmium tolerance in Arabidopsis.
    Plant Mol. Biol., 2019. 99(1-2): p. 149-159
    [PMID:30617455]