![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462907897 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 139aa MW: 15649.8 Da PI: 10.701 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 100.7 | 9e-32 | 61 | 119 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver ae p++v++tYeg+H h+
462907897 61 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEAPRMVITTYEGRHVHS 119
59********************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 5.5E-33 | 46 | 119 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 2.35E-28 | 53 | 120 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 28.323 | 56 | 121 | IPR003657 | WRKY domain |
| SMART | SM00774 | 3.2E-35 | 61 | 120 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 4.5E-25 | 62 | 118 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 139 aa Download sequence Send to blast |
MRNQDKQRGK GAALTAGSGG APALGVGAVR MKKSGSGGGK ARRKVREPRF CFKTMSDVDV 60 LDDGYKWRKY GQKVVKNTQH PRSYYRCTQD NCRVKKRVER LAEAPRMVIT TYEGRHVHSP 120 SRDEDDDAAR ANAEMSFIW |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 3e-26 | 52 | 118 | 8 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 3e-26 | 52 | 118 | 8 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462907897 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT036900 | 1e-127 | BT036900.1 Zea mays full-length cDNA clone ZM_BFb0146L21 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001132878.1 | 7e-74 | uncharacterized protein LOC100194371 | ||||
| Swissprot | Q9SVB7 | 1e-54 | WRK13_ARATH; Probable WRKY transcription factor 13 | ||||
| TrEMBL | A0A1E5WH29 | 2e-76 | A0A1E5WH29_9POAL; Putative WRKY transcription factor 13 | ||||
| STRING | GRMZM2G151444_P01 | 3e-73 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1138 | 38 | 130 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G39410.1 | 9e-49 | WRKY DNA-binding protein 13 | ||||




