PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462912290

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

WRKY

Protein Properties

Length: 118aa MW: 13689.5 Da PI: 10.2087

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462912290	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	99.9	1.5e-31	61	118	1	58
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++dp++v++tYeg+Hnh 462912290 61 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCNVKKRVERDKDDPSYVVTTYEGTHNH 118 59*******************************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	1.5E-31	55	118	IPR003657	WRKY domain
PROSITE profile	PS50811	31.066	56	118	IPR003657	WRKY domain
SuperFamily	SSF118290	8.76E-28	56	118	IPR003657	WRKY domain
SMART	SM00774	6.2E-32	61	118	IPR003657	WRKY domain
Pfam	PF03106	1.9E-25	62	118	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 118 aa Download sequence Send to blast
MPRRPTSCRR RIAPATVAQA QPLGEWRASL LLGRWFLFDR GFQLVIGLER GGGERSEIEI 60 LDDGYKWRKY GKKSVKNSPN PRNYYRCSTE GCNVKKRVER DKDDPSYVVT TYEGTHNH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	8e-26	56	118	12	74	Probable WRKY transcription factor 4
2lex_A	8e-26	56	118	12	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462912290

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT055592	1e-86	BT055592.2 Zea mays full-length cDNA clone ZM_BFc0056L23 mRNA, complete cds.
GenBank	KJ728363	1e-86	KJ728363.1 Zea mays clone pUT6645 WRKY transcription factor (WRKY82) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012700101.1	4e-42	probable WRKY transcription factor 50
Refseq	XP_025807486.1	4e-42	WRKY transcription factor SUSIBA2-like
Swissprot	Q8VWQ5	4e-35	WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBL	A0A059Q168	5e-41	A0A059Q168_9POAL; WRKY transcription factor
STRING	Pavir.Ca01747.1.p	1e-41	(Panicum virgatum)
STRING	Pavir.J03284.1.p	1e-41	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP441	37	206

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G26170.1	2e-32	WRKY DNA-binding protein 50

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821]