![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462913881 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 177aa MW: 19080.4 Da PI: 10.0989 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 136.9 | 1.3e-42 | 24 | 137 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++l+++g
462913881 24 LPPGFRFHPTDEELVVHYLKKKAASLPLPV-TIIAEVDLYKFDPWELPEKASFGEHEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILASGG--- 119
79****************************.89***************9999999***************************************544... PP
NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
r+pkg kt+W+mheyrl
462913881 120 ----------SRDPKGLKTNWIMHEYRL 137
..........489*************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 9.68E-53 | 20 | 143 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 38.915 | 24 | 177 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.4E-22 | 25 | 137 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 177 aa Download sequence Send to blast |
MESTDSSSGS APPQQKPPGP APHLPPGFRF HPTDEELVVH YLKKKAASLP LPVTIIAEVD 60 LYKFDPWELP EKASFGEHEW YFFSPRDRKY PNGARPNRAA TSGYWKATGT DKPILASGGS 120 RDPKGLKTNW IMHEYRLTDA ASSANTSRPP PPGAGAGGGG GSSKAAASLR VRNVRTT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 7e-57 | 14 | 139 | 7 | 144 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 7e-57 | 14 | 139 | 7 | 144 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 7e-57 | 14 | 139 | 7 | 144 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 7e-57 | 14 | 139 | 7 | 144 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
| 3swm_B | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
| 3swm_C | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
| 3swm_D | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
| 3swp_A | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
| 3swp_B | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
| 3swp_C | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
| 3swp_D | 6e-57 | 14 | 139 | 10 | 147 | NAC domain-containing protein 19 |
| 4dul_A | 7e-57 | 14 | 139 | 7 | 144 | NAC domain-containing protein 19 |
| 4dul_B | 7e-57 | 14 | 139 | 7 | 144 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor of the NAC family associated with male fertility. {ECO:0000250}. | |||||
| UniProt | Transcription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462913881 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT085989 | 1e-113 | BT085989.1 Zea mays full-length cDNA clone ZM_BFc0095M07 mRNA, complete cds. | |||
| GenBank | BT086467 | 1e-113 | BT086467.1 Zea mays full-length cDNA clone ZM_BFc0169O24 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002463039.1 | 1e-88 | NAC transcription factor NAM-B2 | ||||
| Swissprot | A2YMR0 | 3e-89 | NAC10_ORYSI; NAC transcription factor ONAC010 | ||||
| Swissprot | Q8H4S4 | 4e-89 | NAC10_ORYSJ; NAC domain-containing protein 10 | ||||
| TrEMBL | A0A0E0ALI9 | 3e-87 | A0A0E0ALI9_9ORYZ; Uncharacterized protein | ||||
| TrEMBL | C5XBN1 | 3e-87 | C5XBN1_SORBI; Uncharacterized protein | ||||
| STRING | OGLUM07G18780.1 | 5e-88 | (Oryza glumipatula) | ||||
| STRING | Sb02g036620.1 | 5e-88 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP7572 | 36 | 49 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G61110.1 | 4e-69 | NAC domain containing protein 25 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




