![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462916576 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 72aa MW: 8203.21 Da PI: 4.4119 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 46.9 | 9.1e-15 | 17 | 70 | 1 | 55 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaee 55
l pGf FhP+dee++ +yL++kv++ ++++ +i e+di+++ePw+Lp k+k +e
462916576 17 LKPGFCFHPSDEEIIPCYLTPKVHDYNFTA-VTIGEADINTSEPWELPCKAKMGE 70
579************************999.66***************6655554 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 3.66E-16 | 14 | 72 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 17.058 | 17 | 72 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.3E-5 | 19 | 60 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 72 aa Download sequence Send to blast |
MEDNHQLQQG AERPLNLKPG FCFHPSDEEI IPCYLTPKVH DYNFTAVTIG EADINTSEPW 60 ELPCKAKMGE KE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462916576 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022989901.1 | 4e-23 | NAC domain-containing protein 92-like | ||||
| Swissprot | Q9FK44 | 7e-22 | NAC87_ARATH; NAC domain-containing protein 87 | ||||
| TrEMBL | A0A1J7HLV1 | 4e-21 | A0A1J7HLV1_LUPAN; Uncharacterized protein | ||||
| TrEMBL | A0A444ZP69 | 1e-21 | A0A444ZP69_ARAHY; Uncharacterized protein | ||||
| STRING | Lus10026879 | 4e-23 | (Linum usitatissimum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G18270.2 | 7e-25 | Arabidopsis NAC domain containing protein 87 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




