![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462917328 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 87aa MW: 10067.4 Da PI: 4.9776 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 81.1 | 1.7e-25 | 28 | 86 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+y++++d+ +++++sw e+ ++fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y
462917328 28 FLTKTYQLVDDPCTDHIVSWGEDDTTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTY 86
9*********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.6E-27 | 20 | 86 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 1.1E-19 | 24 | 87 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 4.49E-23 | 27 | 86 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 1.5E-21 | 28 | 86 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.6E-16 | 28 | 51 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.6E-16 | 66 | 78 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.6E-16 | 79 | 87 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 87 aa Download sequence Send to blast |
MAFLVERCGE MVVSMESSPH AKPVPAPFLT KTYQLVDDPC TDHIVSWGED DTTFVVWRPP 60 EFARDLLPNY FKHNNFSSFV RQLNTYV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ldu_A | 2e-16 | 24 | 86 | 17 | 78 | Heat shock factor protein 1 |
| 5d5u_B | 2e-16 | 24 | 86 | 26 | 87 | Heat shock factor protein 1 |
| 5d5v_B | 2e-16 | 24 | 86 | 26 | 87 | Heat shock factor protein 1 |
| 5d5v_D | 2e-16 | 24 | 86 | 26 | 87 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000269|PubMed:16202242}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462917328 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT054148 | 1e-104 | BT054148.1 Zea mays full-length cDNA clone ZM_BFb0133K13 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025804091.1 | 2e-58 | heat stress transcription factor B-4b-like | ||||
| Swissprot | Q7XHZ0 | 4e-55 | HFB4B_ORYSJ; Heat stress transcription factor B-4b | ||||
| TrEMBL | A0A1E5VCU8 | 4e-57 | A0A1E5VCU8_9POAL; Heat stress transcription factor B-4b | ||||
| TrEMBL | A0A2S3H4D8 | 5e-57 | A0A2S3H4D8_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A2T7EZ90 | 4e-57 | A0A2T7EZ90_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A3L6QPD0 | 5e-57 | A0A3L6QPD0_PANMI; Heat stress transcription factor B-4b-like | ||||
| STRING | Pavir.J32257.1.p | 8e-57 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP121 | 37 | 394 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G46264.1 | 7e-42 | heat shock transcription factor B4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




