![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462919173 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 74aa MW: 8337.66 Da PI: 6.9264 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 78.1 | 1.1e-24 | 18 | 64 | 4 | 51 |
G2-like 4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
++WtpeLH+rFv+aveqL G++kA+P++ile+m++++Lt+++++SHLQ
462919173 18 VDWTPELHRRFVQAVEQL-GIDKAVPSRILEIMGIECLTRHNIASHLQ 64
68****************.***************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 2.23E-16 | 17 | 65 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 2.7E-24 | 18 | 65 | IPR006447 | Myb domain, plants |
| Gene3D | G3DSA:1.10.10.60 | 5.6E-22 | 18 | 64 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.1E-6 | 19 | 64 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
MKSEAFTANC STIAHFGVDW TPELHRRFVQ AVEQLGIDKA VPSRILEIMG IECLTRHNIA 60 SHLQVAIVIY WCGN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional activator that promotes chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport (By similarity). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462919173 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By light. {ECO:0000269|PubMed:11340194}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP099309 | 4e-45 | FP099309.1 Phyllostachys edulis cDNA clone: bphyem212o08, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022877224.1 | 1e-28 | transcription activator GLK1-like isoform X1 | ||||
| Swissprot | Q5NAN5 | 5e-27 | GLK2_ORYSJ; Probable transcription factor GLK2 | ||||
| TrEMBL | A0A067E6T8 | 1e-26 | A0A067E6T8_CITSI; Uncharacterized protein | ||||
| TrEMBL | A0A2I4DEU0 | 8e-27 | A0A2I4DEU0_JUGRE; transcription activator GLK1-like isoform X1 | ||||
| STRING | Pavir.J11422.1.p | 5e-28 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2415 | 38 | 86 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G20570.1 | 1e-27 | GBF's pro-rich region-interacting factor 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




