PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462919983

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

MYB_related

Protein Properties

Length: 85aa MW: 10090 Da PI: 10.2802

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462919983	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	60.2	4.5e-19	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEde+l + ++++G g+W+t+++ g+ R++k+c++rw +yl 462919983 14 KGLWSPEEDEKLMNHITKHGHGCWSTVPKLAGLQRCGKSCRLRWINYL 61 678*******************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.9E-27	6	68	IPR009057	Homeodomain-like
SuperFamily	SSF46689	8.97E-19	7	68	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.586	9	65	IPR017930	Myb domain
SMART	SM00717	6.5E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.6E-16	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	6.93E-10	17	61	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 85 aa Download sequence Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLMNHIT KHGHGCWSTV PKLAGLQRCG KSCRLRWINY 60 LRPDLKRXXX XXXXXXXXXX XXLEQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that coordinates a small network of downstream target genes required for several aspects of plant growth and development, such as xylem formation and xylem cell differentiation, and lateral root formation (PubMed:22708996). Regulates a specific set of target genes by binding DNA to the AC cis-element 5'-ACCTAC-3' (PubMed:23741471). Functions as a transcriptional regulator of stomatal closure. Plays a role the regulation of stomatal pore size independently of abscisic acid (ABA) (PubMed:16005292). Required for seed coat mucilage deposition during the development of the seed coat epidermis (PubMed:19401413). Involved in the induction of trichome initiation and branching by positively regulating GL1 and GL2. Required for gibberellin (GA) biosynthesis and degradation by positively affecting the expression of the enzymes that convert GA9 into the bioactive GA4, as well as the enzymes involved in the degradation of GA4 (PubMed:28207974). {ECO:0000269\|PubMed:16005292, ECO:0000269\|PubMed:19401413, ECO:0000269\|PubMed:22708996, ECO:0000269\|PubMed:23741471, ECO:0000269\|PubMed:28207974}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462919983

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT055234	3e-83	BT055234.2 Zea mays full-length cDNA clone ZM_BFb0155L05 mRNA, complete cds.
GenBank	HF679417	3e-83	HF679417.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB11 protein.
GenBank	KJ726901	3e-83	KJ726901.1 Zea mays clone pUT3446 MYB transcription factor (MYB128) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003626126.1	2e-44	transcription factor MYB61
Refseq	XP_006305129.1	1e-44	transcription factor MYB61
Refseq	XP_010490115.1	1e-44	PREDICTED: transcription repressor MYB6-like
Swissprot	Q8VZQ2	6e-42	MYB61_ARATH; Transcription factor MYB61
TrEMBL	R0GQ49	3e-43	R0GQ49_9BRAS; Uncharacterized protein
STRING	AES82344	7e-44	(Medicago truncatula)
STRING	XP_006305129.1	5e-44	(Capsella rubella)
STRING	XP_010490115.1	5e-44	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP21121	6	6

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G09540.1	2e-44	myb domain protein 61

Publications ? help Back to Top
Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Matías-Hernández L, et al. AaMYB1 and its orthologue AtMYB61 affect terpene metabolism and trichome development in Artemisia annua and Arabidopsis thaliana. Plant J., 2017. 90(3): p. 520-534 [PMID:28207974]