![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462921327 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 127aa MW: 13829.8 Da PI: 4.8011 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 68.8 | 1.1e-21 | 52 | 110 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl k++e++ed++++ ++sw + nsfvv+d++ fa ++Lp+ Fkh nf+ F+RQLn+Y
462921327 52 FLAKTFEMVEDPATDGVVSWGAARNSFVVWDPHAFAARLLPRRFKHANFSTFLRQLNTY 110
9********************999*********************************** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 1.4E-23 | 44 | 112 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 1.5E-20 | 48 | 113 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 7.6E-20 | 48 | 126 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 1.9E-18 | 52 | 110 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 3.3E-12 | 52 | 75 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 3.3E-12 | 90 | 102 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 3.3E-12 | 103 | 115 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 127 aa Download sequence Send to blast |
MENPAAVTVK QELQDDDEVV VVVQDGHCDG AAAPAPAPLE KLSAAAAAVA PFLAKTFEMV 60 EDPATDGVVS WGAARNSFVV WDPHAFAARL LPRRFKHANF STFLRQLNTY VRNQMQITLL 120 LLVITID |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 9e-15 | 38 | 110 | 15 | 87 | Heat shock factor protein 1 |
| 5d5v_B | 9e-15 | 38 | 110 | 15 | 87 | Heat shock factor protein 1 |
| 5d5v_D | 9e-15 | 38 | 110 | 15 | 87 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462921327 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK372701 | 4e-71 | AK372701.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3009M23. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022681569.1 | 2e-40 | putative heat stress transcription factor A-6a | ||||
| TrEMBL | B6TKC4 | 3e-40 | B6TKC4_MAIZE; Heat shock factor protein HSF30 | ||||
| STRING | Pavir.Da00715.1.p | 1e-47 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP121 | 37 | 394 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26150.1 | 2e-26 | heat shock transcription factor A2 | ||||




