![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462923223 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 111aa MW: 12838.9 Da PI: 10.8103 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 58.8 | 1.2e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+WT Ede+l+ +vk +G g W+ ++++ g++R++k+c++rw++yl
462923223 14 RGAWTSKEDEILAAYVKAHGEGKWREVPQRAGLRRCGKSCRLRWLNYL 61
89*********************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 3.9E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 24.898 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.6E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.4E-16 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 3.51E-22 | 15 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 7.35E-9 | 16 | 61 | No hit | No description |
| PROSITE profile | PS50090 | 4.356 | 62 | 101 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 2.8E-7 | 65 | 88 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 111 aa Download sequence Send to blast |
MGRKACCAKE GVKRGAWTSK EDEILAAYVK AHGEGKWREV PQRAGLRRCG KSCRLRWLNY 60 LRPNIKRGNI SDDEEDLIIR LHKLLGNRSV RSRAHEQIDP WASKFKLKLV N |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462923223 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025812125.1 | 1e-54 | anthocyanin regulatory C1 protein-like | ||||
| Swissprot | P10290 | 7e-54 | MYBC_MAIZE; Anthocyanin regulatory C1 protein | ||||
| TrEMBL | A0A1E5WII7 | 7e-54 | A0A1E5WII7_9POAL; Anthocyanin regulatory C1 protein | ||||
| TrEMBL | A0A368QS51 | 6e-54 | A0A368QS51_SETIT; Uncharacterized protein | ||||
| TrEMBL | Q8W0U3 | 2e-53 | Q8W0U3_SORBI; Putative anthocyanin regulatory C1 | ||||
| STRING | Pavir.Db02046.1.p | 4e-55 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP116 | 37 | 448 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G13540.1 | 5e-42 | myb domain protein 5 | ||||




