![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462923258 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 95aa MW: 9980.52 Da PI: 9.4258 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 79.6 | 5.5e-25 | 3 | 88 | 288 | 374 |
GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
++l+rei+nv+a g +r + + +++Wre+l ++GF++++l +aa+qa+lll +++sdgy++ ee+g+l lgWkd L+++SaWr
462923258 3 VCLSREIRNVLAVGGPARSGDVK-FGSWREKLAQSGFRAASLAGSAAAQASLLLGMFPSDGYTLVEENGALKLGWKDLCLLTASAWR 88
699**************988887.**************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50985 | 11.003 | 1 | 68 | IPR005202 | Transcription factor GRAS |
| Pfam | PF03514 | 1.9E-22 | 3 | 88 | IPR005202 | Transcription factor GRAS |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MPVCLSREIR NVLAVGGPAR SGDVKFGSWR EKLAQSGFRA ASLAGSAAAQ ASLLLGMFPS 60 DGYTLVEENG ALKLGWKDLC LLTASAWRPI QTSVG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5b3g_A | 7e-42 | 5 | 89 | 296 | 380 | Protein SCARECROW |
| 5b3h_A | 7e-42 | 5 | 89 | 295 | 379 | Protein SCARECROW |
| 5b3h_D | 7e-42 | 5 | 89 | 295 | 379 | Protein SCARECROW |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in establishing and maintaining the correct radial pattern in the root apical meristem. {ECO:0000269|PubMed:10948251}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462923258 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP094510 | 2e-78 | FP094510.1 Phyllostachys edulis cDNA clone: bphylf057n24, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021317511.1 | 2e-52 | protein SCARECROW | ||||
| Swissprot | Q9FUZ7 | 3e-53 | SCR_MAIZE; Protein SCARECROW | ||||
| TrEMBL | A0A0E0BMX4 | 1e-52 | A0A0E0BMX4_9ORYZ; Uncharacterized protein | ||||
| TrEMBL | A0A1Z5RG85 | 5e-51 | A0A1Z5RG85_SORBI; Uncharacterized protein | ||||
| TrEMBL | C0P5W3 | 3e-52 | C0P5W3_MAIZE; Uncharacterized protein | ||||
| STRING | OGLUM12G01020.1 | 2e-53 | (Oryza glumipatula) | ||||
| STRING | Sb05g001500.1 | 7e-52 | (Sorghum bicolor) | ||||
| STRING | GRMZM2G131516_P02 | 1e-51 | (Zea mays) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1371 | 38 | 122 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54220.1 | 9e-33 | GRAS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




