PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462924105

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

NAC

Protein Properties

Length: 122aa MW: 14433.6 Da PI: 10.7886

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462924105	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	98.4	1e-30	5	79	54	128
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + +++++ +glkktLvfy+g+apkg++++W+m+eyrl 462924105 5 GEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRAENSRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 79 789**********************************************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	33.028	1	99	IPR003441	NAC domain
SuperFamily	SSF101941	1.44E-32	3	86	IPR003441	NAC domain
Pfam	PF02365	3.0E-13	9	79	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 122 aa Download sequence Send to blast
MAAIGEKEWF FYVPRDRKYR NGDRPNRVTA SGYWKATGAD RMIRAENSRP IGLKKTLVFY 60 SGKAPKGVRS SWIMNEYRLP PDDTDRYHKV FLLPTSYFLP WHTVDHTKKR HHTRLLPNPP 120 RC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3swm_A	3e-32	2	79	69	145	NAC domain-containing protein 19
3swm_B	3e-32	2	79	69	145	NAC domain-containing protein 19
3swm_C	3e-32	2	79	69	145	NAC domain-containing protein 19
3swm_D	3e-32	2	79	69	145	NAC domain-containing protein 19
3swp_A	3e-32	2	79	69	145	NAC domain-containing protein 19
3swp_B	3e-32	2	79	69	145	NAC domain-containing protein 19
3swp_C	3e-32	2	79	69	145	NAC domain-containing protein 19
3swp_D	3e-32	2	79	69	145	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269\|PubMed:17653269}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462924105

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269\|PubMed:17653269}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT033902	1e-114	BT033902.1 Zea mays full-length cDNA clone ZM_BFc0061J19 mRNA, complete cds.
GenBank	BT039864	1e-114	BT039864.1 Zea mays full-length cDNA clone ZM_BFc0047I12 mRNA, complete cds.
GenBank	EU957131	1e-114	EU957131.1 Zea mays clone 1583712 hypothetical protein mRNA, complete cds.
GenBank	KJ728024	1e-114	KJ728024.1 Zea mays clone pUT6160 NAC transcription factor (NAC95) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015695832.1	1e-56	PREDICTED: NAC transcription factor ONAC010
Swissprot	Q9ZVP8	8e-51	NAC35_ARATH; NAC domain-containing protein 35
TrEMBL	A0A1E5WH59	2e-56	A0A1E5WH59_9POAL; NAC domain-containing protein 35
STRING	LPERR01G34330.2	3e-56	(Leersia perrieri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2826	37	87

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G02450.1	3e-53	NAC domain containing protein 35

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Okajima K Molecular mechanism of phototropin light signaling. J. Plant Res., 2016. 129(2): p. 149-57 [PMID:26815763] Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii. J Phys Chem B, 2018. 122(6): p. 1801-1815 [PMID:29355019]