![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462925416 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 92aa MW: 10216.9 Da PI: 9.5704 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 66.9 | 3.6e-21 | 7 | 61 | 1 | 55 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsf 55
++yk+kaal+ +++ p+f+ ldsg+ k+ ++G +ll++a+a+a+r+ydW++kq+
462925416 7 GIYKGKAALSFDPRPPQFVPLDSGAYKVAKEGCVLLQFAPAVATRQYDWSRKQNR 61
79**************************************************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF08536 | 4.0E-20 | 8 | 60 | IPR013742 | Plant transcription factor |
| Gene3D | G3DSA:2.30.31.10 | 2.5E-22 | 8 | 59 | IPR009044 | ssDNA-binding transcriptional regulator |
| SuperFamily | SSF54447 | 1.96E-26 | 8 | 86 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene3D | G3DSA:2.30.31.10 | 3.3E-4 | 60 | 86 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 92 aa Download sequence Send to blast |
MARRMGGIYK GKAALSFDPR PPQFVPLDSG AYKVAKEGCV LLQFAPAVAT RQYDWSRKQN 60 RLLNIDESIY IPISKGEFAV IVSTLNNCDL PV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1l3a_A | 2e-22 | 8 | 67 | 44 | 103 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_B | 2e-22 | 8 | 67 | 44 | 103 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_C | 2e-22 | 8 | 67 | 44 | 103 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_D | 2e-22 | 8 | 67 | 44 | 103 | p24: plant transcriptional regulator PBF-2 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA and RNA binding protein that maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. Functions in RNA metabolism and is involved in the maturation of the atpF and 23S ribosomal RNAs. {ECO:0000269|PubMed:18676978, ECO:0000269|PubMed:19666500}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462925416 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CT836194 | 8e-47 | CT836194.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA048P18, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004964538.1 | 7e-40 | single-stranded DNA-binding protein WHY1, chloroplastic isoform X2 | ||||
| Swissprot | B2LXS7 | 8e-28 | WHY1_MAIZE; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
| TrEMBL | A0A2T8JET6 | 6e-36 | A0A2T8JET6_9POAL; Uncharacterized protein | ||||
| STRING | ORGLA06G0029900.1 | 6e-30 | (Oryza glaberrima) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP3012 | 38 | 85 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G02740.2 | 3e-23 | ssDNA-binding transcriptional regulator | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




