![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462929181 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 148aa MW: 16116.1 Da PI: 10.2781 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 104.9 | 4.4e-33 | 69 | 127 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK vk+s +prsYYrCt+++C+vkk+v+r a+d+++v++tYeg Hnh+
462929181 69 LDDGYRWRKYGQKAVKNSAHPRSYYRCTHHTCNVKKQVQRLAKDTSIVVTTYEGVHNHP 127
59********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 1.1E-33 | 55 | 127 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 9.42E-29 | 62 | 128 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 28.449 | 64 | 129 | IPR003657 | WRKY domain |
| SMART | SM00774 | 2.0E-38 | 69 | 128 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 2.4E-26 | 70 | 127 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 148 aa Download sequence Send to blast |
MSPAATVPPG LQEAVRVDQS GENDGGGEAG GSGSEKAGKG GGAGRSPSGK KKVSRPRFAF 60 QTRSVNDILD DGYRWRKYGQ KAVKNSAHPR SYYRCTHHTC NVKKQVQRLA KDTSIVVTTY 120 EGVHNHPCEK LMEALSPILK QLQFLSQF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 9e-25 | 60 | 126 | 8 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 9e-25 | 60 | 126 | 8 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00539 | DAP | Transfer from AT5G41570 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462929181 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK108909 | 1e-115 | AK108909.1 Oryza sativa Japonica Group cDNA clone:002-152-G06, full insert sequence. | |||
| GenBank | AY341845 | 1e-115 | AY341845.1 Oryza sativa (japonica cultivar-group) WRKY4 mRNA, complete cds. | |||
| GenBank | AY870607 | 1e-115 | AY870607.1 Oryza sativa (japonica cultivar-group) WRKY23 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004969857.1 | 3e-80 | probable WRKY transcription factor 56 | ||||
| Swissprot | Q9FFS3 | 2e-57 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
| TrEMBL | A0A1E5UIW3 | 8e-83 | A0A1E5UIW3_9POAL; Putative WRKY transcription factor 24 | ||||
| STRING | Si002751m | 1e-79 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1100 | 38 | 133 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G41570.1 | 2e-57 | WRKY DNA-binding protein 24 | ||||




