![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462931688 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 155aa MW: 17348.7 Da PI: 9.9958 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 64.9 | 1.6e-20 | 23 | 76 | 1 | 54 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqs 54
s+yk+kaal+ +++ p+f+ ldsg+ k+ ++G +ll++a+a+a+r+ydW++kq
462931688 23 SIYKGKAALSFDPRPPQFVPLDSGAYKVAKEGCVLLQFAPAVATRQYDWSRKQI 76
7***************************************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.30.31.10 | 1.4E-27 | 10 | 76 | IPR009044 | ssDNA-binding transcriptional regulator |
| SuperFamily | SSF54447 | 1.18E-45 | 16 | 155 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 1.1E-19 | 24 | 76 | IPR013742 | Plant transcription factor |
| Gene3D | G3DSA:2.30.31.10 | 2.9E-15 | 90 | 140 | IPR009044 | ssDNA-binding transcriptional regulator |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0045910 | Biological Process | negative regulation of DNA recombination | ||||
| GO:0009570 | Cellular Component | chloroplast stroma | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003723 | Molecular Function | RNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 155 aa Download sequence Send to blast |
SRDGYGRSPA NGAQDGRVFT SYSIYKGKAA LSFDPRPPQF VPLDSGAYKV AKEGCVLLQF 60 APAVATRQYD WSRKQIRASF FMTLLRGGGV QNRLLNIDES IYIPISKGEF AVIVSTLNFI 120 IPHLMGWSTF TSSIKPEDSR SYSRPQSGPE FEWQR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1l3a_A | 2e-48 | 12 | 154 | 32 | 219 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_B | 2e-48 | 12 | 154 | 32 | 219 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_C | 2e-48 | 12 | 154 | 32 | 219 | p24: plant transcriptional regulator PBF-2 |
| 1l3a_D | 2e-48 | 12 | 154 | 32 | 219 | p24: plant transcriptional regulator PBF-2 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA and RNA binding protein that maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. Functions in RNA metabolism and is involved in the maturation of the atpF and 23S ribosomal RNAs. {ECO:0000269|PubMed:18676978, ECO:0000269|PubMed:19666500}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462931688 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT043360 | 1e-59 | BT043360.1 Zea mays full-length cDNA clone ZM_BFc0169P08 mRNA, complete cds. | |||
| GenBank | BT062297 | 1e-59 | BT062297.1 Zea mays full-length cDNA clone ZM_BFb0277C12 mRNA, complete cds. | |||
| GenBank | BT063034 | 1e-59 | BT063034.1 Zea mays full-length cDNA clone ZM_BFc0018K04 mRNA, complete cds. | |||
| GenBank | EU595664 | 1e-59 | EU595664.1 Zea mays Whirly family nucleic acid binding protein (WHY1) mRNA, complete cds. | |||
| GenBank | EU955861 | 1e-59 | EU955861.1 Zea mays clone 1549286 DNA-binding protein p24 mRNA, complete cds. | |||
| GenBank | JX469972 | 1e-59 | JX469972.1 Zea mays subsp. mays clone UT3235 WHIRLY-type transcription factor mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004964538.1 | 2e-83 | single-stranded DNA-binding protein WHY1, chloroplastic isoform X2 | ||||
| Swissprot | B2LXS7 | 2e-76 | WHY1_MAIZE; Single-stranded DNA-binding protein WHY1, chloroplastic | ||||
| TrEMBL | A0A2T8JET6 | 5e-79 | A0A2T8JET6_9POAL; Uncharacterized protein | ||||
| STRING | Si006951m | 3e-77 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP3012 | 38 | 85 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G02740.2 | 1e-51 | ssDNA-binding transcriptional regulator | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




