PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462934431
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family LBD
Protein Properties Length: 149aa    MW: 15928.2 Da    PI: 9.1539
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462934431genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260113.61.3e-351199188
     DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeq.pkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqle 88
               +C aCk+lrrkCa++Cv+ap+f+ae+ +++fa++hk+FGasn  kll+++ + +r++a+++++yeA+ar+rdP+yG+v++i++lqqq +
  462934431 11 PCGACKFLRRKCAAECVFAPHFCAEDgAAQFAAIHKVFGASNAAKLLQQVAPGDRSEAAATVTYEAQARLRDPIYGCVAHIFALQQQAA 99
               7***********************9989**********************************************************976 PP

2DUF26038.14.5e-12961325591
     DUF260  55 edamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                ++a+++++yeA+ar+rdP+yG+v++i++lqqq++ + 
  462934431  96 QQAAATVTYEAQARLRDPIYGCVAHIFALQQQVRVHT 132
                6899****************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089120.58110112IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-341199IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-996132IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MASSAGGAGS PCGACKFLRR KCAAECVFAP HFCAEDGAAQ FAAIHKVFGA SNAAKLLQQV  60
APGDRSEAAA TVTYEAQARL RDPIYGCVAH IFALQQQAAA TVTYEAQARL RDPIYGCVAH  120
IFALQQQVRV HTSTSTLAFL WSPARSRRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-33297296LOB family transfactor Ramosa2.1
5ly0_B5e-33297296LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:19717544, PubMed:22974309). Involved in lateral root formation. Regulated by the transcriptional activators ARF7 and ARF19 (PubMed:17259263). Functions in the initiation and emergence of lateral roots, in conjunction with LBD18, downstream of ARF7 and ARF19 (PubMed:19717544, PubMed:23749813). Acts downstream of the auxin influx carriers AUX1 and LAX1 in the regulation of lateral root initiation and development (PubMed:26059335). {ECO:0000269|PubMed:17259263, ECO:0000269|PubMed:19717544, ECO:0000269|PubMed:22974309, ECO:0000269|PubMed:23749813, ECO:0000269|PubMed:26059335}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap462934431
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:15659631, ECO:0000269|PubMed:17259263, ECO:0000269|PubMed:23749813}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0517341e-126EF051734.1 Zea mays RTCN mRNA, complete cds.
GenBankKJ7283751e-126KJ728375.1 Zea mays clone pUT6657 LOB transcription factor (LOB21) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632118.12e-59LOB domain-containing protein 16
SwissprotQ9SLB73e-45LBD16_ARATH; LOB domain-containing protein 16
TrEMBLA0A0E0K8T74e-58A0A0E0K8T7_ORYPU; Uncharacterized protein
STRINGOPUNC03G03510.17e-59(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP102623344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58190.14e-46lateral organ boundaries-domain 29
Publications ? help Back to Top
  1. Bargmann BO,Birnbaum KD,Brenner ED
    An undergraduate study of two transcription factors that promote lateral root formation.
    Biochem Mol Biol Educ, 2014 May-Jun. 42(3): p. 237-45
    [PMID:24615800]
  2. Cabrera J,Fenoll C,Escobar C
    Genes co-regulated with LBD16 in nematode feeding sites inferred from in silico analysis show similarities to regulatory circuits mediated by the auxin/cytokinin balance in Arabidopsis.
    Plant Signal Behav, 2015. 10(3): p. e990825
    [PMID:25664644]
  3. Lee HW, et al.
    Dimerization in LBD16 and LBD18 Transcription Factors Is Critical for Lateral Root Formation.
    Plant Physiol., 2017. 174(1): p. 301-311
    [PMID:28336771]
  4. Olmo R, et al.
    Molecular Transducers from Roots Are Triggered in Arabidopsis Leaves by Root-Knot Nematodes for Successful Feeding Site Formation: A Conserved Post-Embryogenic De novo Organogenesis Program?
    Front Plant Sci, 2017. 8: p. 875
    [PMID:28603536]
  5. Lee K,Seo PJ
    High-temperature promotion of callus formation requires the BIN2-ARF-LBD axis in Arabidopsis.
    Planta, 2017. 246(4): p. 797-802
    [PMID:28766014]
  6. Jeon E, et al.
    LBD14/ASL17 Positively Regulates Lateral Root Formation and is Involved in ABA Response for Root Architecture in Arabidopsis.
    Plant Cell Physiol., 2017. 58(12): p. 2190-2201
    [PMID:29040694]
  7. Pandey SK,Kim J
    Coiled-coil motif in LBD16 and LBD18 transcription factors are critical for dimerization and biological function in arabidopsis.
    Plant Signal Behav, 2018. 13(1): p. e1411450
    [PMID:29227192]
  8. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  9. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]
  10. Lee HW, et al.
    LBD16 and LBD18 acting downstream of ARF7 and ARF19 are involved in adventitious root formation in Arabidopsis.
    BMC Plant Biol., 2019. 19(1): p. 46
    [PMID:30704405]