PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462936052

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

TALE

Protein Properties

Length: 140aa MW: 16624 Da PI: 9.6702

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462936052	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	31.9	2.3e-10	66	101	20	55
HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 +k +yps++e+ LA+++gL+++q+ +WF N+R ++ 462936052 66 YKWPYPSETEKIALAESTGLDQKQINNWFINQRKRH 101 5679*****************************985 PP
2	ELK	39.6	1.1e-13	21	42	1	22
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK qLl+KYsgyL+sL+qEFs 462936052 21 ELKYQLLKKYSGYLSSLRQEFS 42 9********************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03789	1.2E-10	21	42	IPR005539	ELK domain
SMART	SM01188	1.2E-7	21	42	IPR005539	ELK domain
PROSITE profile	PS51213	11.627	21	41	IPR005539	ELK domain
PROSITE profile	PS50071	12.892	41	104	IPR001356	Homeobox domain
SuperFamily	SSF46689	1.75E-20	42	116	IPR009057	Homeodomain-like
SMART	SM00389	4.4E-13	43	108	IPR001356	Homeobox domain
Gene3D	G3DSA:1.10.10.60	1.3E-28	46	105	IPR009057	Homeodomain-like
CDD	cd00086	4.02E-12	53	105	No hit	No description
Pfam	PF05920	2.2E-17	61	100	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	79	102	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 140 aa Download sequence Send to blast
MDTSGRENEP PEIDPRAEDK ELKYQLLKKY SGYLSSLRQE FSKKKKKGKL PKEARQKLLH 60 WWELHYKWPY PSETEKIALA ESTGLDQKQI NNWFINQRKR HWKPSEDMPF VMMEGFHPQN 120 AAALYMDGPF MADGMYRLGS

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693}.
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693, ECO:0000269\|PubMed:9869405}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462936052

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FP101469	1e-153	FP101469.1 Phyllostachys edulis cDNA clone: bphyst005d10, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002459312.1	2e-99	homeobox protein rough sheath 1 isoform X2
Refseq	XP_021307878.1	5e-99	homeobox protein rough sheath 1 isoform X1
Swissprot	O65034	1e-100	KNOSC_ORYSI; Homeobox protein knotted-1-like 12
Swissprot	O80416	1e-100	KNOSC_ORYSJ; Homeobox protein knotted-1-like 12
TrEMBL	A0A2T7EKK8	1e-98	A0A2T7EKK8_9POAL; Uncharacterized protein
TrEMBL	A0A3L6PCB7	1e-98	A0A3L6PCB7_PANMI; Homeobox protein rough sheath 1-like (Fragment)
STRING	Pavir.Ba03909.1.p	6e-99	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP4061	38	73

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G08150.1	1e-56	KNOTTED-like from Arabidopsis thaliana

Publications ? help Back to Top
Sato Y, et al. Loss-of-function mutations in the rice homeobox gene OSH15 affect the architecture of internodes resulting in dwarf plants. EMBO J., 1999. 18(4): p. 992-1002 [PMID:10022841] Ito Y,Eiguchi M,Kurata N KNOX homeobox genes are sufficient in maintaining cultured cells in an undifferentiated state in rice. Genesis, 2001. 30(4): p. 231-8 [PMID:11536429] Nagasaki H,Sakamoto T,Sato Y,Matsuoka M Functional analysis of the conserved domains of a rice KNOX homeodomain protein, OSH15. Plant Cell, 2001. 13(9): p. 2085-98 [PMID:11549765] Postma-Haarsma AD, et al. Developmental regulation and downstream effects of the knox class homeobox genes Oskn2 and Oskn3 from rice. Plant Mol. Biol., 2002. 48(4): p. 423-41 [PMID:11908517] Kuijt SJ, et al. Different subcellular localization and trafficking properties of KNOX class 1 homeodomain proteins from rice. Plant Mol. Biol., 2004. 55(6): p. 781-96 [PMID:15604716] Yin H, et al. SUI-family genes encode phosphatidylserine synthases and regulate stem development in rice. Planta, 2013. 237(1): p. 15-27 [PMID:22956125]