![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462936362 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 93aa MW: 10692.3 Da PI: 10.1239 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 62 | 7.3e-20 | 28 | 59 | 1 | 32 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrk 32
C++Cg+ +Tp+WR+gp+g++tLCnaCG++yr
462936362 28 CRHCGAEETPQWRQGPEGPRTLCNACGVRYRA 59
******************************95 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57716 | 6.18E-15 | 21 | 81 | No hit | No description |
| PROSITE profile | PS50114 | 11.833 | 22 | 58 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 3.4E-16 | 22 | 76 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 1.3E-15 | 26 | 59 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 4.10E-12 | 27 | 76 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 28 | 53 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 1.2E-17 | 28 | 59 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 93 aa Download sequence Send to blast |
MGFRDYYTTP VYKDLQLPAA AAGKQKQCRH CGAEETPQWR QGPEGPRTLC NACGVRYRAG 60 LLLPAYRPLR SPTFSPELHT NVRRRIVEMC RRQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes. {ECO:0000269|PubMed:12139008}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462936362 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020594258.1 | 6e-32 | GATA transcription factor 1-like | ||||
| Swissprot | Q8LAU9 | 4e-30 | GATA1_ARATH; GATA transcription factor 1 | ||||
| TrEMBL | I1H9U0 | 2e-29 | I1H9U0_BRADI; Uncharacterized protein | ||||
| STRING | BRADI1G75420.1 | 3e-30 | (Brachypodium distachyon) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1417 | 33 | 108 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G24050.1 | 2e-32 | GATA transcription factor 1 | ||||




