PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462937915

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

MYB_related

Protein Properties

Length: 103aa MW: 11767.8 Da PI: 10.3047

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462937915	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	52.2	1.4e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed++lv +++++G g W +++ g++R++k+c++rw++yl 462937915 14 RGAWTAMEDDILVSYIRKHGEGKWGCLPKRAGLKRCGKSCRLRWLNYL 61 89*********************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.2E-22	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	21.178	9	65	IPR017930	Myb domain
SMART	SM00717	1.0E-11	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	9.7E-15	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.21E-20	15	88	IPR009057	Homeodomain-like
CDD	cd00167	2.14E-9	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	6.1E-7	65	87	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 103 aa Download sequence Send to blast
MGRKPCCLKE GLNRGAWTAM EDDILVSYIR KHGEGKWGCL PKRAGLKRCG KSCRLRWLNY 60 LRPGIKRGNI SDDEEELIIR LHRLLGNSAS YPLKMNQLLG QQS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	1e-13	7	87	20	99	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462937915

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002465146.1	7e-54	anthocyanin regulatory C1 protein
Swissprot	P10290	1e-42	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	A0A287MHZ1	5e-53	A0A287MHZ1_HORVV; Uncharacterized protein
TrEMBL	C5WWN5	2e-52	C5WWN5_SORBI; Uncharacterized protein
STRING	Sb01g032770.1	3e-53	(Sorghum bicolor)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP116	37	448

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G07690.1	4e-34	myb domain protein 29

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]