![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462940434 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 113aa MW: 12640.2 Da PI: 9.9689 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 128.5 | 2.6e-40 | 2 | 75 | 5 | 78 |
TT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
SBP 5 egCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
++C a+l eak+yh+rhkvCe+h+kapvv+v+gl+qrfCqqCsrfhelsefD+ krsCr rLa+hnerrrk++a
462940434 2 DRCGAELGEAKRYHKRHKVCEAHAKAPVVIVAGLRQRFCQQCSRFHELSEFDDIKRSCRLRLAGHNERRRKSSA 75
79*********************************************************************976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51141 | 29.487 | 1 | 73 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 9.8E-31 | 2 | 72 | IPR004333 | Transcription factor, SBP-box |
| Gene3D | G3DSA:4.10.1100.10 | 6.2E-30 | 2 | 60 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 3.14E-36 | 2 | 77 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 113 aa Download sequence Send to blast |
ADRCGAELGE AKRYHKRHKV CEAHAKAPVV IVAGLRQRFC QQCSRFHELS EFDDIKRSCR 60 LRLAGHNERR RKSSAEAHGP PPPGPSSSDP CRHADQDGRS HPGNPPLGNF QIR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 3e-33 | 1 | 72 | 13 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00634 | PBM | Transfer from PK22320.1 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462940434 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | - | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP091672 | 9e-72 | FP091672.1 Phyllostachys edulis cDNA clone: bphylf033o15, full insert sequence. | |||
| GenBank | FP094478 | 9e-72 | FP094478.1 Phyllostachys edulis cDNA clone: bphyst005i03, full insert sequence. | |||
| GenBank | FP096626 | 9e-72 | FP096626.1 Phyllostachys edulis cDNA clone: bphylf027p18, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003560169.3 | 1e-51 | squamosa promoter-binding-like protein 13 | ||||
| Swissprot | Q6Z461 | 4e-44 | SPL13_ORYSJ; Squamosa promoter-binding-like protein 13 | ||||
| TrEMBL | A0A385UKL6 | 6e-55 | A0A385UKL6_WHEAT; GLW7 | ||||
| TrEMBL | A0A446M6U6 | 6e-55 | A0A446M6U6_TRITD; Uncharacterized protein | ||||
| TrEMBL | A0A446M6X2 | 2e-55 | A0A446M6X2_TRITD; Uncharacterized protein | ||||
| STRING | Traes_2BS_186EA570A.1 | 1e-55 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP8524 | 32 | 48 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G53160.2 | 1e-36 | squamosa promoter binding protein-like 4 | ||||




