![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462944543 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 118aa MW: 13369.3 Da PI: 9.8227 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 100 | 1.6e-31 | 45 | 95 | 1 | 51 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
kprl+WtpeLHerFv+av+qLGG+ekAtPkti++lm+++gLtl+h+kSHLQ
462944543 45 KPRLKWTPELHERFVDAVNQLGGPEKATPKTIMRLMGIPGLTLYHLKSHLQ 95
79************************************************* PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 10.032 | 42 | 102 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.5E-29 | 43 | 95 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 2.33E-15 | 44 | 96 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.2E-21 | 45 | 96 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 4.6E-10 | 47 | 96 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MYHQQQQQLQ SHNQHLSSRH SLPPEKQFLV QGGGDSGLIL STDAKPRLKW TPELHERFVD 60 AVNQLGGPEK ATPKTIMRLM GIPGLTLYHL KSHLQYLAAG RQQINYVKET DHQPATII |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4r_A | 3e-21 | 45 | 101 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_B | 3e-21 | 45 | 101 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_C | 3e-21 | 45 | 101 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_D | 3e-21 | 45 | 101 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462944543 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002463407.1 | 2e-52 | myb-related protein 1 | ||||
| Swissprot | Q9SQQ9 | 2e-36 | PHL9_ARATH; Myb-related protein 2 | ||||
| TrEMBL | A0A0A9DHX6 | 1e-52 | A0A0A9DHX6_ARUDO; Uncharacterized protein | ||||
| STRING | Sb02g043320.1 | 9e-52 | (Sorghum bicolor) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP20734 | 6 | 7 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G18240.3 | 2e-36 | myb-related protein 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




