PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462946170

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

MYB

Protein Properties

Length: 247aa MW: 26626.6 Da PI: 9.6428

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462946170	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	55.3	1.5e-17	38	83	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ed +l+++v+q+G+ +W++Ia+++ gR++k+c++rw++ 462946170 38 RGHWRPAEDAKLKELVAQHGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 83 899***************************.*********996 PP
2	Myb_DNA-binding	56.8	5.2e-18	90	134	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 r +++ eE+e+l+ a++ +G++ W++I+r ++ gRt++++k++w+ + 462946170 90 RRAFSDEEEERLLAAHRAYGNK-WALISRLFP-GRTDNSVKNHWHVL 134 6789****************.*****.*********987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	17.525	33	84	IPR017930	Myb domain
SMART	SM00717	2.4E-14	37	86	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-16	38	83	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	4.69E-28	38	135	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	6.1E-27	39	91	IPR009057	Homeodomain-like
CDD	cd00167	2.84E-14	41	82	No hit	No description
PROSITE profile	PS51294	26.481	85	139	IPR017930	Myb domain
SMART	SM00717	2.8E-15	89	137	IPR001005	SANT/Myb domain
Pfam	PF00249	7.0E-15	90	134	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.4E-20	92	137	IPR009057	Homeodomain-like
CDD	cd00167	2.16E-12	92	135	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 247 aa Download sequence Send to blast
MAHDMAGVFG PTPPERHVVE QGGHGYGGSG GQGKLCARGH WRPAEDAKLK ELVAQHGPQN 60 WNLIAEKLDG RSGKSCRLRW FNQLDPRINR RAFSDEEEER LLAAHRAYGN KWALISRLFP 120 GRTDNSVKNH WHVLMARRQR EQSGALRRRK TSSSSTPPGA APHFASPVVH HLPYYGSTAP 180 PFHGGGGGVP LDAAATDASR AYSGGGDSDE SASTCTTDLS LGSAGAPVPC FYQRQSTYGP 240 SSLHAVL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-30	36	138	5	107	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269\|PubMed:20305120}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462946170

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by wounding. {ECO:0000269\|PubMed:20305120}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU967775	1e-142	EU967775.1 Zea mays clone 305974 mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020187176.1	1e-100	transcriptional activator Myb-like
Swissprot	Q5NBM8	4e-84	CSA_ORYSJ; Transcription factor CSA
TrEMBL	A0A446PNW9	1e-100	A0A446PNW9_TRITD; Uncharacterized protein
STRING	Pavir.J31094.1.p	1e-98	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP294	38	260

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69560.1	2e-66	myb domain protein 105

Publications ? help Back to Top
Leonard LM,Follette VM Sexual functioning in women reporting a history of child sexual abuse: review of the empirical literature and clinical implications. Annu Rev Sex Res, 2002. 13: p. 346-88 [PMID:12836736] Wang L,Li X,Chen Z Sulfated modification of the polysaccharides obtained from defatted rice bran and their antitumor activities. Int. J. Biol. Macromol., 2009. 44(2): p. 211-4 [PMID:19135473] Wang L,Huang H,Wei Y,Li X,Chen Z Characterization and anti-tumor activities of sulfated polysaccharide SRBPS2a obtained from defatted rice bran. Int. J. Biol. Macromol., 2009. 45(4): p. 427-31 [PMID:19549538] Zhang H, et al. Carbon starved anther encodes a MYB domain protein that regulates sugar partitioning required for rice pollen development. Plant Cell, 2010. 22(3): p. 672-89 [PMID:20305120] Zhang H, et al. Mutation in CSA creates a new photoperiod-sensitive genic male sterile line applicable for hybrid rice seed production. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(1): p. 76-81 [PMID:23256151] Zhu X, et al. Brassinosteroids promote development of rice pollen grains and seeds by triggering expression of Carbon Starved Anther, a MYB domain protein. Plant J., 2015. 82(4): p. 570-81 [PMID:25754973] Li X, et al. Metabolic and transcriptomic signatures of rice floral organs reveal sugar starvation as a factor in reproductive failure under heat and drought stress. Plant Cell Environ., 2015. 38(10): p. 2171-92 [PMID:25828772] Shaar-Moshe L,Hübner S,Peleg Z Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach. BMC Plant Biol., 2015. 15: p. 111 [PMID:25935420]