![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462965173 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 126aa MW: 14365.7 Da PI: 9.9955 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 50.3 | 5.5e-16 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g W++eEd++l d++ ++G g+W++ +++ g+ R +k+c++rw +yl
462965173 15 KGLWSPEEDQKLRDYIVRYGHGCWSALPAKAGLQRNGKSCRLRWINYL 62
678*******************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 20.369 | 10 | 66 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 5.1E-22 | 10 | 65 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 2.4E-11 | 14 | 64 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 4.2E-14 | 15 | 62 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 9.84E-21 | 17 | 89 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 8.41E-11 | 18 | 62 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 5.6E-7 | 66 | 89 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 126 aa Download sequence Send to blast |
MGCKACQKPK VQYRKGLWSP EEDQKLRDYI VRYGHGCWSA LPAKAGLQRN GKSCRLRWIN 60 YLRPGLKHGM FSREEEDTVM SLHAKLGNKK GALLMFAMET ALSGGVDADI YAPYRVTRLH 120 LFPVHD |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462965173 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP091592 | 1e-108 | FP091592.1 Phyllostachys edulis cDNA clone: bphylf055c23, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004976342.1 | 4e-58 | transcription factor LAF1 | ||||
| Refseq | XP_025823961.1 | 4e-58 | transcription factor LAF1-like | ||||
| Swissprot | Q9M0K4 | 9e-39 | LAF1_ARATH; Transcription factor LAF1 | ||||
| TrEMBL | A0A2S3I9F5 | 1e-56 | A0A2S3I9F5_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A2T7CXV3 | 1e-56 | A0A2T7CXV3_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A3L6FXG2 | 1e-56 | A0A3L6FXG2_MAIZE; Transcription factor LAF1 | ||||
| TrEMBL | A0A3L6PTV3 | 1e-56 | A0A3L6PTV3_PANMI; Transcription factor LAF1-like | ||||
| TrEMBL | K3YDJ9 | 1e-56 | K3YDJ9_SETIT; Uncharacterized protein | ||||
| STRING | Si012304m | 2e-57 | (Setaria italica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP1707 | 37 | 109 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G25560.1 | 4e-41 | myb domain protein 18 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




