![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462967441 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 76aa MW: 7208.96 Da PI: 6.2152 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 58 | 2.2e-18 | 37 | 69 | 3 | 35 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegee 35
+vrY+eCl+NhAa+lGgh+vDGCgEfmp g+
462967441 37 EVRYHECLRNHAAALGGHVVDGCGEFMPGAGAG 69
79**************************86554 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04770 | 4.6E-15 | 38 | 70 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| ProDom | PD125774 | 2.0E-10 | 38 | 74 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 1.9E-15 | 39 | 69 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 18.28 | 40 | 76 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 76 aa Download sequence Send to blast |
MGTPPAAAVP RALPPTAAAS SSSGNGAGAS AAAAPPEVRY HECLRNHAAA LGGHVVDGCG 60 EFMPGAGAGD DALKSN |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription factor. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462967441 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP096968 | 2e-34 | FP096968.1 Phyllostachys edulis cDNA clone: bphyst021i04, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_025810260.1 | 4e-21 | zinc-finger homeodomain protein 6-like | ||||
| Swissprot | B8AX53 | 1e-15 | ZHD6_ORYSI; Zinc-finger homeodomain protein 6 | ||||
| TrEMBL | A0A2S3H9A7 | 9e-20 | A0A2S3H9A7_9POAL; Uncharacterized protein | ||||
| TrEMBL | A0A2T7E9Z6 | 1e-19 | A0A2T7E9Z6_9POAL; Uncharacterized protein | ||||
| STRING | Pavir.Ca01004.1.p | 9e-20 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP815 | 35 | 145 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G75240.1 | 6e-12 | homeobox protein 33 | ||||




