![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 462969128 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 82aa MW: 8971.29 Da PI: 9.1038 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 75.9 | 6.8e-24 | 11 | 71 | 2 | 62 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTE CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgF 62
F+ k+y ++ed+ ++ +i w + +nsf+v d+ f++++Lp +Fkh+nf+SFvRQLn+Y F
462969128 11 FVWKTYMMVEDPGTDGVIGWGRGNNSFIVADPFVFSQTLLPAHFKHNNFSSFVRQLNTYIF 71
9**********************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00415 | 2.1E-15 | 7 | 82 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene3D | G3DSA:1.10.10.10 | 9.4E-26 | 8 | 71 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 1.63E-22 | 10 | 71 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 1.8E-13 | 11 | 34 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 5.3E-19 | 11 | 71 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.8E-13 | 49 | 61 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 1.8E-13 | 62 | 74 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 82 aa Download sequence Send to blast |
MAAGGGAAAP FVWKTYMMVE DPGTDGVIGW GRGNNSFIVA DPFVFSQTLL PAHFKHNNFS 60 SFVRQLNTYI FGVREIFLLG GK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5w_B | 7e-18 | 8 | 71 | 1 | 64 | Putative transcription factor |
| 5d5x_B | 7e-18 | 8 | 71 | 1 | 64 | Putative transcription factor |
| 5d5x_E | 7e-18 | 8 | 71 | 1 | 64 | Putative transcription factor |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 462969128 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JX540975 | 3e-77 | JX540975.1 Paspalum vaginatum clone StvSingle_HKZDOCN01AUS53 microsatellite sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004965592.1 | 1e-43 | heat stress transcription factor C-2b | ||||
| Swissprot | Q0DBL6 | 2e-37 | HFC2B_ORYSJ; Heat stress transcription factor C-2b | ||||
| TrEMBL | A0A368QVH6 | 3e-42 | A0A368QVH6_SETIT; Uncharacterized protein | ||||
| STRING | Pavir.J36148.1.p | 2e-38 | (Panicum virgatum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP121 | 37 | 394 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G24520.1 | 6e-29 | heat shock transcription factor C1 | ||||




