PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

462969836

Organism

Eragrostis tef

Taxonomic ID

110835

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis

Family

MYB_related

Protein Properties

Length: 94aa MW: 10666.2 Da PI: 9.3753

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
462969836	genome	Tef	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.8	4.5e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT+eEd +l+ +G+g+W+t++++ g++R++k+c++r+ +yl 462969836 14 KGLWTPEEDAKLLAFTSTHGTGNWTTVPQRAGLKRCGKSCRLRYTNYL 61 678*******************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	3.5E-24	5	65	IPR009057	Homeodomain-like
PROSITE profile	PS51294	22.242	9	65	IPR017930	Myb domain
SMART	SM00717	3.9E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.9E-15	14	61	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	3.91E-22	16	89	IPR009057	Homeodomain-like
CDD	cd00167	4.52E-11	17	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.5E-7	66	89	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MGRPPCCDKA NVKKGLWTPE EDAKLLAFTS THGTGNWTTV PQRAGLKRCG KSCRLRYTNY 60 LRPNLKHENF TQEEEELIVT LHAMLGSRYC SRGP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	8e-15	14	91	7	83	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Required for anther development and early tapetal function during microspore maturation (PubMed:18397379, PubMed:21957980). Regulates callose dissolution required for microspores release from the tetrads (PubMed:18397379). {ECO:0000269\|PubMed:18397379, ECO:0000269\|PubMed:21957980}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	462969836

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT086266	1e-113	BT086266.1 Zea mays full-length cDNA clone ZM_BFc0140J15 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015630216.1	2e-58	transcription factor MYB35
Swissprot	Q9LSI7	5e-45	MYB35_ARATH; Transcription factor MYB35
TrEMBL	A2XFL0	4e-58	A2XFL0_ORYSI; Uncharacterized protein
STRING	ORGLA03G0133600.1	8e-58	(Oryza glaberrima)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP11874	34	39

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28470.1	2e-47	MYB family protein

Publications ? help Back to Top
Tsugama D, et al. A putative MYB35 ortholog is a candidate for the sex-determining genes in Asparagus officinalis. Sci Rep, 2017. 7: p. 41497 [PMID:28176806] Lou Y, et al. Positive regulation of AMS by TDF1 and the formation of a TDF1-AMS complex are required for anther development in Arabidopsis thaliana. New Phytol., 2018. 217(1): p. 378-391 [PMID:28940573] Li DD,Xue JS,Zhu J,Yang ZN Gene Regulatory Network for Tapetum Development in Arabidopsis thaliana. Front Plant Sci, 2017. 8: p. 1559 [PMID:28955355]