![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 474435 | ||||||||
| Common Name | ARALYDRAFT_474435 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 174aa MW: 19938.3 Da PI: 10.1381 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 134 | 4.8e-42 | 54 | 129 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
Cqv++C++d++eak yhrrhkvCevh+ka++v++sgl+qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk++
474435 54 CQVDRCTSDMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHELQEFDEAKRSCRRRLAGHNERRRKSS 129
**************************************************************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PIRSF | PIRSF037575 | 2.5E-62 | 1 | 141 | IPR017238 | Squamosa promoter-binding protein |
| Gene3D | G3DSA:4.10.1100.10 | 1.0E-32 | 48 | 115 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 31.932 | 51 | 128 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 1.03E-37 | 53 | 131 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 9.6E-32 | 54 | 127 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 174 aa Download sequence Send to blast |
MEGKRTQGQG YLKKKSYRVE EEMEYDTDGE EEVGRDRVRG SSGSIDRGGS SRLCQVDRCT 60 SDMKEAKLYH RRHKVCEVHA KASSVFLSGL NQRFCQQCSR FHELQEFDEA KRSCRRRLAG 120 HNERRRKSSG ESSFGEGSGR RGITGQVIQN QERSRVEMTL PMPNSSFKRP QIR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 5e-50 | 40 | 127 | 1 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00634 | PBM | Transfer from PK22320.1 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 474435 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY084902 | 0.0 | AY084902.1 Arabidopsis thaliana clone 12071 mRNA, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020867200.1 | 1e-114 | squamosa promoter-binding-like protein 4 isoform X1 | ||||
| Refseq | XP_020867201.1 | 1e-114 | squamosa promoter-binding-like protein 4 isoform X1 | ||||
| Swissprot | Q9S7A9 | 1e-103 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
| TrEMBL | D7KKE3 | 1e-122 | D7KKE3_ARALL; Squamosa promoter-binding-like protein | ||||
| STRING | fgenesh2_kg.1__4389__AT1G53160.2 | 1e-123 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM868 | 28 | 118 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G53160.2 | 2e-74 | squamosa promoter binding protein-like 4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 474435 |
| Entrez Gene | 9327793 |




