![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 49084 | ||||||||
| Common Name | SELMODRAFT_49084 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 110aa MW: 12159 Da PI: 8.3838 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 143.2 | 8.1e-45 | 2 | 100 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
+CaaCk+lrr+Ca+dC++apyfp ++p+kfa+vhk+FGasnv+k+l++lp ++r da+ s+vyeA+ar+rdPvyG+vg i++l+qq++ql+++la ++
49084 2 PCAACKLLRRRCAQDCIFAPYFPPDEPQKFAFVHKVFGASNVSKMLQDLPLHQRGDAVGSMVYEANARVRDPVYGCVGAISALHQQIAQLQTQLAISQA 100
7*********************************************************************************************99886 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 25.954 | 1 | 102 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.2E-44 | 2 | 99 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009965 | Biological Process | leaf morphogenesis | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 110 aa Download sequence Send to blast |
SPCAACKLLR RRCAQDCIFA PYFPPDEPQK FAFVHKVFGA SNVSKMLQDL PLHQRGDAVG 60 SMVYEANARV RDPVYGCVGA ISALHQQIAQ LQTQLAISQA ENVCLRMQHS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 2e-47 | 1 | 101 | 10 | 110 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 2e-47 | 1 | 101 | 10 | 110 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002984853.2 | 5e-78 | LOB domain-containing protein 4 | ||||
| Swissprot | Q8LBW3 | 6e-61 | LBD12_ARATH; LOB domain-containing protein 12 | ||||
| TrEMBL | D8SN28 | 9e-76 | D8SN28_SELML; Uncharacterized protein (Fragment) | ||||
| STRING | EFJ14103 | 2e-76 | (Selaginella moellendorffii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP60 | 16 | 318 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G30130.1 | 5e-53 | LBD family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 49084 |
| Entrez Gene | 9645000 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




