![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 50253 | ||||||||
| Common Name | MICPUCDRAFT_50253 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Mamiellaceae; Micromonas; Micromonas pusilla
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 149aa MW: 16912 Da PI: 9.9018 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 84.8 | 8.2e-27 | 67 | 120 | 2 | 55 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES- CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYege 55
dDgy+WrKYGqK +kgs+fprsYY+Cts++ +++k+ve+sa++pk+ ++tY+++
50253 67 DDGYRWRKYGQKLIKGSPFPRSYYKCTSENSSMQKHVEQSADNPKLYVVTYHSD 120
8**************************************************875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50811 | 24.019 | 61 | 123 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 6.6E-25 | 62 | 120 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 3.4E-22 | 62 | 119 | IPR003657 | WRKY domain |
| SMART | SM00774 | 2.6E-26 | 66 | 122 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.7E-21 | 67 | 119 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009723 | Biological Process | response to ethylene | ||||
| GO:0009751 | Biological Process | response to salicylic acid | ||||
| GO:0009753 | Biological Process | response to jasmonic acid | ||||
| GO:1900150 | Biological Process | regulation of defense response to fungus | ||||
| GO:1900425 | Biological Process | negative regulation of defense response to bacterium | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 149 aa Download sequence Send to blast |
MNRDKNKLFV TGYKTSENVK VETPTEPGTA SLKRRRFNVN DTSTQDAGSN VILEYRVVAH 60 TSDIRIDDGY RWRKYGQKLI KGSPFPRSYY KCTSENSSMQ KHVEQSADNP KLYVVTYHSD 120 RSQANVVYAK LKESAPTLSK ITMHGLDE* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 5e-21 | 66 | 117 | 17 | 68 | Probable WRKY transcription factor 4 |
| 2lex_A | 5e-21 | 66 | 117 | 17 | 68 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003054981.1 | 1e-108 | wrky-like transcription factor | ||||
| Swissprot | Q9XI90 | 2e-20 | WRKY4_ARATH; Probable WRKY transcription factor 4 | ||||
| TrEMBL | C1MHM4 | 1e-107 | C1MHM4_MICPC; Wrky-like transcription factor | ||||
| STRING | XP_003054981.1 | 1e-108 | (Micromonas pusilla) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Chlorophytae | OGCP469 | 16 | 26 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G13960.1 | 7e-23 | WRKY DNA-binding protein 4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 50253 |
| Entrez Gene | 9680379 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




