![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | 57991.m000014 | ||||||||
| Common Name | RCOM_2137700 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 173aa MW: 19782.2 Da PI: 5.88 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 173.8 | 1.8e-54 | 28 | 124 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
vreqdrf+Pianv+rim+++lP +akis+daket+qecvse+isf+tsea+++cqre+rkti+++d+l+a+++lGf+dy+epl+vyl++yreleg+
57991.m000014 28 VREQDRFMPIANVIRIMRRILPPHAKISDDAKETIQECVSEYISFITSEANERCQREQRKTITAEDVLYAMSKLGFDDYIEPLTVYLHRYRELEGD 123
69*********************************************************************************************9 PP
NF-YB 97 k 97
+
57991.m000014 124 R 124
7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.1E-51 | 23 | 130 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 8.54E-39 | 31 | 128 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.1E-25 | 34 | 98 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 7.9E-18 | 62 | 80 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 65 | 81 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 7.9E-18 | 81 | 99 | No hit | No description |
| PRINTS | PR00615 | 7.9E-18 | 100 | 118 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009738 | Biological Process | abscisic acid-activated signaling pathway | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0033613 | Molecular Function | activating transcription factor binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 173 aa Download sequence Send to blast |
MNMRLDEINH SNHTNNNHNT ADDNECTVRE QDRFMPIANV IRIMRRILPP HAKISDDAKE 60 TIQECVSEYI SFITSEANER CQREQRKTIT AEDVLYAMSK LGFDDYIEPL TVYLHRYREL 120 EGDRNSIRSE PLVKRSVEFG TLGVTAAYAP GLYPMGHPHG FFGGAAVGGY MRD |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 8e-61 | 27 | 119 | 5 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | 57991.m000014 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002540255.2 | 1e-129 | nuclear transcription factor Y subunit B-6, partial | ||||
| Swissprot | Q84W66 | 2e-68 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | B9TPT6 | 1e-127 | B9TPT6_RICCO; Ccaat-binding transcription factor subunit A, putative (Fragment) | ||||
| STRING | XP_002540255.1 | 1e-128 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2728 | 32 | 79 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 4e-68 | nuclear factor Y, subunit B6 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | 57991.m000014 |




